KEGG   Staphylococcus aureus 08BA02176: C248_2462Help
Entry
C248_2462         CDS       T02339                                 

Definition
(GenBank) putative phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
saub  Staphylococcus aureus 08BA02176
Pathway
saub00010  Glycolysis / Gluconeogenesis
saub00260  Glycine, serine and threonine metabolism
saub00680  Methane metabolism
saub01100  Metabolic pathways
saub01110  Biosynthesis of secondary metabolites
saub01120  Microbial metabolism in diverse environments
saub01130  Biosynthesis of antibiotics
saub01200  Carbon metabolism
saub01230  Biosynthesis of amino acids
Module
saub_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
saub_M00002  Glycolysis, core module involving three-carbon compounds
saub_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:saub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C248_2462
  09102 Energy metabolism
   00680 Methane metabolism
    C248_2462
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C248_2462
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:saub04131]
    C248_2462
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saub04147]
    C248_2462
Enzymes [BR:saub01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     C248_2462
Membrane trafficking [BR:saub04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    C248_2462
Exosome [BR:saub04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   C248_2462
  Exosomal proteins of melanoma cells
   C248_2462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFR74402
LinkDB All DBs
Position
complement(2456213..2456899)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgccatcgatgtagcttttacatcgttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgagcgtcactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaggaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccacctgctgaaaccgaagaacaacgtgaagcttacttagctgatcgtcgatataatcat
ttagataaacgtatgatgccttattccgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattgattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccgcttgtttatgaattaacggatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system