KEGG   Staphylococcus aureus CA-347 (MRSA): CA347_1136Help
Entry
CA347_1136        CDS       T02702                                 

Gene name
prkC
Definition
(GenBank) serine/threonine-protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sauc  Staphylococcus aureus CA-347 (MRSA)
Brite
KEGG Orthology (KO) [BR:sauc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sauc01001]
    CA347_1136 (prkC)
Enzymes [BR:sauc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CA347_1136 (prkC)
Protein kinases [BR:sauc01001]
 Serine/threonine kinases: Other
  Bacterial family
   CA347_1136 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Seadorna_VP7 RIO1 ChlamPMP_M Choline_kinase Kinase-like Sigma_reg_N ETRAMP PNPase
Motif
Other DBs
NCBI-ProteinID: AGO29489
LinkDB All DBs
Structure
PDB: 

Position
1200203..1202197
Genome map
AA seq 664 aa AA seqDB search
MIGKIINERYKIVDKLGGGGMSTVYLAEDTILNIKVAIKAIFIPPREKEETLKRFEREVH
NSSQLSHQNIVSMIDVDEEDDCYYLVMEYIEGPTLSEYIESHGPLSIDTAINFTNQILDG
IKHAHDMRIVHRDIKPQNILIDSNKTLKIFDFGIAKALSETSLTQTNHVLGTVQYFSPEQ
AKGEATDECTDIYSIGIVLYEMLVGEPPFNGETAVSIAIKHIQDSVPNVTTDVRKDIPQS
LSNVILRATEKDKANRYKTIQEMKDDLSSVLHENRANEDVYELDKMKTIAVPLKKEDLAK
HISEHKSNQPKRETTQVPIVNGPAHHQQFQKPEGTVYEPTPKKKSTRKIVLLSLIFSLLM
IALVSFVAMAMFGNKYEETPDVIGKTVKEAEQIFNKNNLKLGKISRSYSDQYPENEIIKT
TPNTGERVERGDSVDVVISKGPEKVKMPNVIGLPKEEALQKLKSLGLKDVTIEKVYNNQA
PKGYIANQSVTANTEIAIHDSNIKLYESLGIKQVYVEDFEHKSFSKAKKALEEKGFKVES
KEEYSDDIDEGDVISQSPKGKSVDEGSTISFVVSKGKKSDSSDVKTTTESVDVPYTGKND
KSQKVKVYIKDKDNDGSTEKGSFDITSDQRIDIPLRIEKGKTASYIVKVDGKTVAEKEVS
YDDI
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgataggaaaaataataaatgaacgatataaaattgtagataagcttggcggcggtggc
atgagtactgtttatcttgcagaagatacgatacttaacattaaagttgcaattaaggcg
atttttataccacctagagaaaaagaagaaacattaaaacgttttgaacgagaagtacat
aactcatcacagctatcacatcaaaatatagtaagtatgatcgatgttgatgaagaagat
gactgttactacttagtaatggaatatattgaaggtccgactttgtctgagtacattgaa
agtcatgggccattaagtattgacacagcgattaattttacgaatcaaatattggatggc
attaaacatgcgcatgatatgcgtattgtacatagagatattaagccgcaaaatatatta
attgacagcaataaaacgctgaaaatatttgattttggaattgctaaagctttaagtgag
acgtctttaactcagactaatcatgtgttaggtactgtgcagtacttttcaccagaacaa
gcaaaaggtgaggcaacggatgaatgtacagatatttattctataggtattgtgttatat
gaaatgcttgttggtgaaccaccatttaatggagaaactgcagttagcattgcgattaaa
catattcaggattctgtgccaaatgtgacaacagatgtacgtaaggatattccgcaatct
ttaagtaatgtcattttacgtgctacagaaaaagacaaagcgaatcgttacaaaacaatt
caagaaatgaaagatgatttgagtagtgttttacatgaaaatcgagcgaatgaagatgtc
tatgaactcgataaaatgaaaacgatagcggtacctttgaaaaaagaagatctagcaaag
catattagtgaacataagtcgaatcaacctaaacgtgaaacgacgcaagtacctattgta
aatgggcctgctcatcatcagcaattccaaaagccagaaggtacggtgtacgaaccaaca
cctaaaaagaaatcaacacgaaagattgtgctcttatcactaatcttttcgttgttaatg
attgcacttgtttcttttgtggcaatggcaatgtttggtaataaatacgaagagacacct
gatgtaatcgggaaaactgtaaaagaagcagagcaaatattcaataaaaataacctgaaa
ttgggtaaaatttctagaagttatagtgatcaatatcctgaaaatgaaattattaagaca
actcctaatacaggtgaacgtgttgaacgtggtgacagcgttgatgttgttatatcaaaa
ggccctgaaaaggttaaaatgccaaatgtcattggtttacctaaggaggaagccttgcag
aaattaaaatcgttaggtcttaaagatgttacgattgaaaaagtatataataatcaagca
ccaaaaggatacattgcaaatcaaagtgtaaccgcaaatactgaaatcgctattcatgat
tctaatattaaactatatgaatctttaggcattaagcaagtttatgtagaagactttgaa
cataaatcctttagcaaagctaaaaaagccttagaagaaaaaggatttaaagttgaaagt
aaagaagagtatagtgacgatattgatgagggtgatgtaatttctcaatctcctaaaggg
aaatcagtagatgaggggtcaacgatttcatttgttgtttctaaaggtaaaaaaagcgac
tcatcagatgtcaaaacgacaactgaatcggtagatgtaccatacactggtaaaaatgat
aagtcacaaaaagttaaagtttatattaaagataaagataatgacggttcaactgaaaaa
ggtagtttcgacattactagtgatcaacgtatagacattcctttaagaattgaaaaagga
aaaacagcaagttatattgttaaagttgacggtaaaactgtagctgaaaaagaagtcagt
tatgatgatatttaa

DBGET integrated database retrieval system