KEGG   Staphylococcus aureus CA-347 (MRSA): CA347_2201Help
Entry
CA347_2201        CDS       T02702                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sauc  Staphylococcus aureus CA-347 (MRSA)
Pathway
sauc00010  Glycolysis / Gluconeogenesis
sauc00053  Ascorbate and aldarate metabolism
sauc00071  Fatty acid degradation
sauc00280  Valine, leucine and isoleucine degradation
sauc00310  Lysine degradation
sauc00330  Arginine and proline metabolism
sauc00340  Histidine metabolism
sauc00380  Tryptophan metabolism
sauc00410  beta-Alanine metabolism
sauc00561  Glycerolipid metabolism
sauc00620  Pyruvate metabolism
sauc00625  Chloroalkane and chloroalkene degradation
sauc01100  Metabolic pathways
sauc01110  Biosynthesis of secondary metabolites
sauc01120  Microbial metabolism in diverse environments
sauc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sauc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CA347_2201
   00053 Ascorbate and aldarate metabolism
    CA347_2201
   00620 Pyruvate metabolism
    CA347_2201
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CA347_2201
   00561 Glycerolipid metabolism
    CA347_2201
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CA347_2201
   00310 Lysine degradation
    CA347_2201
   00330 Arginine and proline metabolism
    CA347_2201
   00340 Histidine metabolism
    CA347_2201
   00380 Tryptophan metabolism
    CA347_2201
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CA347_2201
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CA347_2201
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CA347_2201
Enzymes [BR:sauc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CA347_2201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra DUF4262
Motif
Other DBs
NCBI-ProteinID: AGO30503
LinkDB All DBs
Structure
PDB: 

Position
complement(2229963..2231390)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADNVYLEFRH
TSVKERQELLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFIAARDALDN
YKFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAA
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVNNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatacattaatggcgaatgggtagaaagtaatagtaatgaa
acgatagaagttataaatccagcaaccgaagaagtaatcgggaaagttgctaaaggtaat
aaagctgatgttgataaagccgtcgaggcggcagacaatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagaattattagacaaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgagttaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaatcattttattgcagcgagagacgcattggataac
tacaaatttgaagaacgccgcggagatgatttagttgttaaagaagcaatcggtgtatct
ggcttaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcagcagca
tttgcggctggtagtccagttgtacttaaaccatctgaagaaacaccatttgcagctgct
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgacggtgctggcgttgggaatcctttatctgaacatcctaaagtacgcatgatgtca
tttacaggatcaggtcctactggttctaaaattatggaaaaagctgctaaagactttaaa
aaggtatcattagagcttggtggcaaatcaccatacatcgtcctagatgacgtagatatt
aaagaagcggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctaacaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcggtaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagag
ggtgctgaattattttatggtggtcctgggaaaccagaaggacttgaaaaagggtacttt
gcacgtccgacaatttttattaatgtaaataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcagttatcacttataacgatttagatgaagcgattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gacttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggctattttaaataa

DBGET integrated database retrieval system