KEGG   Staphylococcus aureus CA-347 (MRSA): CA347_94Help
Entry
CA347_94          CDS       T02702                                 

Definition
(GenBank) thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
sauc  Staphylococcus aureus CA-347 (MRSA)
Pathway
sauc00030  Pentose phosphate pathway
sauc01100  Metabolic pathways
sauc01110  Biosynthesis of secondary metabolites
sauc01120  Microbial metabolism in diverse environments
sauc01130  Biosynthesis of antibiotics
sauc01200  Carbon metabolism
sauc01230  Biosynthesis of amino acids
Module
sauc_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sauc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CA347_94
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    CA347_94
Enzymes [BR:sauc01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     CA347_94
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N DXP_synthase_N TPP_enzyme_C E1_dh
Motif
Other DBs
NCBI-ProteinID: AGO28473
LinkDB All DBs
Position
complement(102310..103086)
Genome map
AA seq 258 aa AA seqDB search
MHFIKSLELDARELRKELIDIANSEYGCHLGGSLSVLDLLYASYINFENSEIILSKGHTC
AALYAILYKLNKLKEKPSLSYGKFNSLLTGHPNHLIPNITFSTGSLGHGLPYGIGVSLSN
KLKQKESGENTIIIGGDGELQEGLIWETLQVASGQNIANFIYIIDKNNGQNDGATSSISP
YHNLKSRFSSYGFDVLEINGHDYKEILESFSKKRANHALVIIANTIKGKGIPSLENNFSS
HYVKINEATAQKWKEELI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcacttcataaaaagtttagaacttgatgctagagaattaagaaaagagctaattgac
attgcaaattcagaatatggttgccacttgggtggttctttatcagttttagatttatta
tacgcttcatatataaatttcgaaaatagcgaaataatacttagcaaaggtcatacatgc
gcagcattatacgctattctctataaattaaataaattaaaagaaaaaccttcattaagt
tatggaaagttcaactcgcttttaactggtcaccctaatcatctaataccaaacataacc
ttctcaactggcagcttaggtcacggtttaccatatggcataggggtgtctttgtctaat
aaattaaagcagaaagagtcaggagaaaatacaataattataggtggtgatggtgagtta
caagaaggtttaatatgggaaactttgcaagtagccagtggtcaaaacattgccaacttt
atttatataatcgataaaaacaatggtcaaaatgatggagcaacttcaagtatctctcct
tatcataacttaaaaagtcgtttttcttcgtatggttttgatgttctagaaattaatgga
catgattataaagagatattagaatcattttcaaaaaaaagagcaaatcacgctctagta
attattgcaaataccattaaaggtaagggaataccttctctagaaaataatttttcatct
cattacgtaaaaatcaatgaggctactgcccaaaaatggaaggaggagttaatttaa

DBGET integrated database retrieval system