KEGG   Staphylococcus aureus 502A: CH52_00750Help
Entry
CH52_00750        CDS       T03491                                 

Definition
(GenBank) competence protein ComK
  KO
K02250  competence protein ComK
Organism
saud  Staphylococcus aureus 502A
Pathway
saud02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:saud00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CH52_00750
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:saud03000]
    CH52_00750
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:saud02044]
    CH52_00750
Transcription factors [BR:saud03000]
 Prokaryotic Type
  Other transcription factors
   Others
    CH52_00750
Secretion system [BR:saud02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   CH52_00750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK Gemin7
Motif
Other DBs
NCBI-ProteinID: AHM68864
UniProt: W8TQM6
LinkDB All DBs
Position
122308..122877
Genome map
AA seq 189 aa AA seqDB search
MYSQNIYVIRKGDMVIRPAFDDDDQRNGSEIIRFDKTRIQNPFKVQKIIERSCKFYGNTY
LGKKAETNRITGISSKPPILLTPLFPTYFFPTHSDRQNENIWLNMHYIESIKELKNRKCK
VTFINNESIILHVSYHSLWHQYNNSIFYYYMVDKQSRMISKNPDQPIDYNKATLNVFEAL
TRYSLFEDK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtattctcaaaatatttatgtgatacgcaaaggagacatggttattcgaccagcattt
gatgatgacgatcaaagaaacggtagtgaaataattcggtttgacaaaacgcgtattcaa
aatccttttaaagtccagaaaatcattgaacgctcttgcaaattttatggtaatacttat
cttggcaagaaagcagagacaaaccgcattactggcatttctagtaaaccacctatttta
ctaacaccattatttccaacttattttttcccaacacattctgacagacaaaatgaaaat
atttggttaaatatgcattatatcgaaagtattaaagaattaaaaaatcgtaaatgtaaa
gtgacatttattaataatgaatctatcattcttcatgtttcataccacagtttatggcat
caatataacaattccattttttactattacatggtagataaacaatctcgcatgatatca
aaaaatcccgaccaaccaatagattataataaagccacattgaatgtgtttgaagcattg
acacgctattctttatttgaagataaataa

DBGET integrated database retrieval system