KEGG   Staphylococcus aureus 502A: CH52_08350Help
Entry
CH52_08350        CDS       T03491                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
saud  Staphylococcus aureus 502A
Pathway
saud00010  Glycolysis / Gluconeogenesis
saud00053  Ascorbate and aldarate metabolism
saud00071  Fatty acid degradation
saud00280  Valine, leucine and isoleucine degradation
saud00310  Lysine degradation
saud00330  Arginine and proline metabolism
saud00340  Histidine metabolism
saud00380  Tryptophan metabolism
saud00410  beta-Alanine metabolism
saud00561  Glycerolipid metabolism
saud00620  Pyruvate metabolism
saud00625  Chloroalkane and chloroalkene degradation
saud01100  Metabolic pathways
saud01110  Biosynthesis of secondary metabolites
saud01120  Microbial metabolism in diverse environments
saud01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saud00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CH52_08350
   00053 Ascorbate and aldarate metabolism
    CH52_08350
   00620 Pyruvate metabolism
    CH52_08350
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CH52_08350
   00561 Glycerolipid metabolism
    CH52_08350
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CH52_08350
   00310 Lysine degradation
    CH52_08350
   00330 Arginine and proline metabolism
    CH52_08350
   00340 Histidine metabolism
    CH52_08350
   00380 Tryptophan metabolism
    CH52_08350
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CH52_08350
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CH52_08350
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CH52_08350
Enzymes [BR:saud01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CH52_08350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHM70316
UniProt: W8U933
LinkDB All DBs
Structure
PDB: 

Position
1742508..1743935
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADDVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatacattaatggcgaatgggtagaaagtaatagtaatgaa
acgatagaagttataaatccagcaaccgaagaagtaatcgggaaagttgctaaaggtaat
aaagctgatgttgataaagccgtcgaggcggcagacgatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagcgttattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgaattaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaaccattttgttgcagcgagagacgcattagataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagcaatcggtgtatct
ggattaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcagcagca
tttgcggctggtagtccagttgtacttaaaccatctgaagaaacaccatttgcagctgtt
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctggtgttgggaatcctttatctgaacatcctaaagtacgcatgatgtca
ttcacaggatcaggccctactggttctaaaattatggaaaaagccgctaaagattttaaa
aaggtatcattagagcttggtggcaaatcaccatatatcgtcctagatgacgtagatatt
aaagaagcggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctaacaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcggtaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagaa
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtagataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcagttatcacttataacgatttagatgaagcgattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gatttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggatattttaaataa

DBGET integrated database retrieval system