KEGG   Staphylococcus aureus subsp. aureus 6850 (MSSA): RSAU_001922Help
Entry
RSAU_001922       CDS       T02825                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
saue  Staphylococcus aureus subsp. aureus 6850 (MSSA)
Pathway
saue00473  D-Alanine metabolism
saue00550  Peptidoglycan biosynthesis
saue01100  Metabolic pathways
saue01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:saue00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RSAU_001922 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RSAU_001922 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    RSAU_001922 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:saue01011]
    RSAU_001922 (ddl)
Enzymes [BR:saue01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RSAU_001922 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:saue01011]
 Precursor biosynthesis
  Amino acid ligase
   RSAU_001922 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AGU55688
LinkDB All DBs
Structure
PDB: 

Position
complement(2056287..2057357)
Genome map
AA seq 356 aa AA seqDB search
MTKENICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDWRKQNNITAEIK
STDELHLENGEALEISQLLKESSSGQPYDAVFPLLHGPNGEDGTIQGLFEVLDVPYVGNG
VLSAASSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEHNILKLVNDKLNYPVFVKPAN
LGSSVGISKCNNEAELKEGIKEAFQFDRKLVIEQGVNAREIEVAVLGNDYPEATWPGEVV
KDVAFYDYKSKYKDGKVQLQIPADLDEDVQLTLRNMALEAFKATDCSGLVRADFFVTEDN
QIYINETNAMPGFTAFSMYPKLWENMGLSYPELITKLIELAKERHQDKQKNKYKID
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaaaatatttgtatcgtttttggagggaaaagtgcagaacacgaagtatcg
attctgacagcacaaaatgtattaaatgcaatagataaagacaaatatcatgttgatatc
atttatattaccaatgatggtgattggagaaagcaaaataatattacagctgaaattaaa
tctactgatgagcttcatttagaaaatggagaggcgcttgagatttcacagctattgaaa
gaaagtagttcaggacaaccatacgatgcagtattcccattattacatggtcctaatggt
gaagatggcacgattcaaggactttttgaagttttggatgtaccatatgtaggaaatggt
gtattgtcagctgcaagttctatggacaagcttgtaatgaaacaattatttgaacaccga
gggttaccacagttaccttatattagtttcttacgttctgaatatgaaaaatatgaacat
aacattttaaaattagtaaatgataaattaaattacccagtctttgttaaacctgctaac
ttagggtcaagtgtaggtatcagtaaatgtaataatgaagcggaacttaaagaaggtatt
aaagaagcattccaatttgaccgtaagcttgttattgaacaaggcgttaacgcacgtgaa
attgaagtagcagttttaggaaatgactatcctgaagcgacatggccaggtgaagtcgta
aaagatgtcgcgttttacgattacaaatcaaaatataaagatggtaaggttcaattacaa
attccagctgacttagacgaagatgttcaattaacgcttagaaatatggcattagaggca
ttcaaagcgacagattgttctggtttagtccgtgctgatttctttgtaacagaagacaac
caaatatatattaatgaaacaaatgcaatgcctggatttacggctttcagtatgtatcca
aagttatgggaaaatatgggcttatcttatccagaattgattacaaaacttatcgagctt
gctaaagaacgtcaccaggataaacagaaaaataaatacaaaattgactaa

DBGET integrated database retrieval system