KEGG   Staphylococcus aureus subsp. aureus 6850 (MSSA): RSAU_001960Help
Entry
RSAU_001960       CDS       T02825                                 

Definition
(GenBank) aldehyde dehydrogenase, putative
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
saue  Staphylococcus aureus subsp. aureus 6850 (MSSA)
Pathway
saue00010  Glycolysis / Gluconeogenesis
saue00053  Ascorbate and aldarate metabolism
saue00071  Fatty acid degradation
saue00280  Valine, leucine and isoleucine degradation
saue00310  Lysine degradation
saue00330  Arginine and proline metabolism
saue00340  Histidine metabolism
saue00380  Tryptophan metabolism
saue00410  beta-Alanine metabolism
saue00561  Glycerolipid metabolism
saue00620  Pyruvate metabolism
saue00625  Chloroalkane and chloroalkene degradation
saue01100  Metabolic pathways
saue01110  Biosynthesis of secondary metabolites
saue01120  Microbial metabolism in diverse environments
saue01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saue00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSAU_001960
   00053 Ascorbate and aldarate metabolism
    RSAU_001960
   00620 Pyruvate metabolism
    RSAU_001960
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RSAU_001960
   00561 Glycerolipid metabolism
    RSAU_001960
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSAU_001960
   00310 Lysine degradation
    RSAU_001960
   00330 Arginine and proline metabolism
    RSAU_001960
   00340 Histidine metabolism
    RSAU_001960
   00380 Tryptophan metabolism
    RSAU_001960
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RSAU_001960
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RSAU_001960
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RSAU_001960
Enzymes [BR:saue01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     RSAU_001960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF4262
Motif
Other DBs
NCBI-ProteinID: AGU55726
LinkDB All DBs
Structure
PDB: 

Position
complement(2089281..2090708)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADNVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGNDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatacattaatggcgaatgggtagaaagtaatagtaatgaa
acgatagaagttataaatccagcaaccgaagaagtaatcgggaaagttgctaaaggtaat
aaagctgatgttgataaagccgtcgaggcggcagacaatgtttatttagagttccgtcat
acatcagtgaaagaaagacaagcgttattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgagttaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaaccattttgttgcagcgagagatgcattggataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagctatcggtgtatct
ggcttaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcagcagca
tttgcggctggtagtccagttgtacttaaaccatctgaagaaacaccatttgcagctgtt
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctggcgttgggaatcctttatctgaacatcctaaagtacgcatgatgtca
tttacaggatcaggccctactggttctaaaattatggaaaaagctgctaaagactttaaa
aaggtatcattagagcttggtggcaaatcaccatacatcgtcctagatgacgtagatatt
aaagaagcggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctaacaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcggtaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagaa
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtagataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcagttatcacttataacgatttagatgaagcgattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaatgacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gacttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagtttttagaagtgaaatctatagctggctattttaaataa

DBGET integrated database retrieval system