KEGG   Staphylococcus aureus subsp. aureus FDAARGOS_5: X998_1422Help
Entry
X998_1422         CDS       T03492                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
sauf  Staphylococcus aureus subsp. aureus FDAARGOS_5
Pathway
sauf00020  Citrate cycle (TCA cycle)
sauf00310  Lysine degradation
sauf00380  Tryptophan metabolism
sauf01100  Metabolic pathways
sauf01110  Biosynthesis of secondary metabolites
sauf01120  Microbial metabolism in diverse environments
sauf01130  Biosynthesis of antibiotics
sauf01200  Carbon metabolism
Module
sauf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sauf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sauf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    X998_1422
  Amino acid metabolism
   00310 Lysine degradation
    X998_1422
   00380 Tryptophan metabolism
    X998_1422
Enzymes [BR:sauf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     X998_1422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N T3SS_HrpK1 DUF1542 DUF1840
Motif
Other DBs
NCBI-ProteinID: AHW66604
LinkDB All DBs
Position
920746..923544
Genome map
AA seq 932 aa AA seqDB search
MTNERKEVSEAPVNFGANLGLMLDLYDDFLQDPSSVPEDLQVLFSTIKNDDSIVPALKST
SSQNSDGTIKRVMRLIDNIRQYGHLKADIYPVNPPKRKHVPKLEIEDFDLDQQTLEGISA
GIVSDHFADIYDNAYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIETPYKVTLNNN
EKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQIGM
AHRGRLNVLTHVLEKPYEMMISEFMHTDPMKFLPEDGSLQLTAGWTGDVKYHLGGIKTTD
SYGTMQRIALANNPSHLEIVAPVVEGRTRAAQDDTQRAGAPTTDHHKAMPIIIHGDAAYP
GQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPIDARSTTYSTDVAKGYDVPIFHV
NADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPVPYQNIRKHDS
VEYVFGKKLVNEGVISEDEMHSFIEQVQKELRQAHDKINKADKMDNPDMEKPADLALPLQ
ADEQSFTFDHLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKEDGLVDWAQAEQLAFA
TILQDGTPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPDQKATFDIHNSPLSEA
AVVGFEYGYNVENKKSFNIWEAQYGDFANMSQMIFDNFLFSSRSKWGERSGLTLFLPHAY
EGQGPEHSSARLERFLQLAAENNCTVVNLSSSSNYFHLLRAQAASLDSEQMRPLVVMSPK
SLLRNKTVAKPIDEFTSGGFEPILTESYQADKVTKVILATGKMFIDLKEALAKNPDESVL
LVAIERLYPFPEEEIEALLAQLPNLEEVSWVQEEPKNQGAWLYVYPYVKVLVADKYDLSY
HGRIQRAAPAEGDGEIHKLVQNKIIENALKNN
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgactaacgaaagaaaagaagtttcagaggctcctgtaaacttcggtgcgaatttaggt
ctaatgttagatctatatgatgactttttacaagatccatcatctgtaccagaagattta
caagtcttattcagcacaattaagaatgatgactcaattgtaccagctttaaaaagtaca
agtagtcaaaatagcgacggcacaattaagcgtgtcatgcgtttaattgataatattcgc
caatacgggcatcttaaagccgatatttatcctgtaaatcctccaaaaaggaaacatgta
cctaaattagagattgaagactttgatttagatcaacagactttggaaggtatatcagca
ggaattgtttcagatcactttgccgacatttatgataatgcttatgaagcaattttaaga
atggaaaaacgttacaaaggaccaattgcatttgagtatacacatattaataacaatacc
gaacgtggttggttaaaaagaagaattgaaacgccatataaagtaacgttaaataataac
gaaaaaagggcactattcaaacaattagcgtatgttgaagggtttgaaaaatatcttcat
aaaaacttcgttggtgcaaagcgtttttcaattgaaggggtagacgcacttgtaccgatg
ttacaacgtactattacgattgctgcgaaagaaggtattaaaaatatacaaataggcatg
gctcaccgtggacgtttaaacgttttaacgcatgtcttagaaaaaccgtacgaaatgatg
atttcagaatttatgcatacagatccaatgaaattcttacctgaagatggtagcttgcag
ttaactgctggatggactggtgatgtgaaatatcaccttggtggcattaaaactactgat
tcatacggtacaatgcagcgtattgcactggctaacaatccaagtcacttggaaattgtt
gcacctgttgttgaggggcgtacgagagcagcacaagatgatacacaacgagctggggct
ccgacgactgatcatcataaagcaatgccaattattatacatggcgatgctgcttatcct
ggtcaaggaattaacttcgaaacaatgaacttaggaaacttgaaaggctattctacgggt
ggttcattgcatattattactaacaatagaattggatttactacagaaccaattgatgca
cgttcaacaacttattctacagatgtggccaaaggttatgatgtgccaatattccatgtc
aatgcagatgacgttgaagctactattgaagcaattgatattgcaatggaatttagaaaa
gagtttcataaagacgtcgttattgatttagtaggttatcgtcgtttcggacataacgaa
atggatgaaccatcaattactaatccagttccttatcagaatattcgcaaacatgactct
gttgaatatgtgtttggtaaaaagcttgttaatgaaggtgtcatttcagaagatgaaatg
cattcatttatagaacaagtccaaaaggaactaagacaagctcatgataaaattaataaa
gctgataaaatggataatccagatatggaaaagcctgcagatcttgcattaccgttacaa
gcagacgaacaatcatttacttttgatcacttgaaagaaataaatgatgcattgttaaca
tatccggatggctttaacattttgaaaaagttaaacaaagttcttgagaagcgtcatgag
ccgtttaataaagaagatggtttagttgattgggcacaagcagaacaacttgcatttgcg
acaattttacaagatggtacaccgattcgcttaactggtcaagatagtgaacgtggtaca
ttcagtcataggcatgccgtgttacatgatgagcaaacaggtgaaacatatacaccttta
catcatgttcctgatcaaaaagcgacatttgatatacacaattctccgctttcagaagca
gcagtagttggttttgaatacggctataatgtggaaaacaaaaaaagcttcaatatttgg
gaagcacaatatggtgattttgcaaatatgtcacaaatgatttttgacaacttcttattc
agttctcgctcaaaatggggagaacgttcaggattaacattattcttacctcatgcatat
gagggtcaagggcctgaacattcatcagcaagattagagcgatttttacaattagctgct
gaaaataattgcacagttgtcaacttatctagttcaagtaattatttccacttattgcgt
gcacaagcggctagtttagattctgaacaaatgcgaccattggttgttatgtcaccaaaa
agcttactgagaaataaaacagttgcaaaaccaattgatgaatttacttctggtggattt
gagccaattttgacagaatcatatcaagcggataaggttacaaaagttattttggcaact
ggtaaaatgttcattgatttaaaagaagcattagctaaaaatccagacgaatcagtatta
ctcgttgcgattgaaagattgtatccattcccagaggaagagattgaagcattactagca
caattgccaaaccttgaagaagtgtcatgggtacaagaagaacctaaaaatcaaggtgca
tggttatatgtctatccatatgttaaagtgctagttgcagataaatatgatttaagttat
catggcagaattcaaagggctgctccagctgaaggcgatggagaaattcataaacttgtt
caaaataaaattatagaaaatgcattaaaaaataactag

DBGET integrated database retrieval system