KEGG   Staphylococcus aureus subsp. aureus SA268 (CA-MRSA): SA268_0146Help
Entry
SA268_0146        CDS       T03790                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
saug  Staphylococcus aureus subsp. aureus SA268 (CA-MRSA)
Pathway
saug00010  Glycolysis / Gluconeogenesis
saug00053  Ascorbate and aldarate metabolism
saug00071  Fatty acid degradation
saug00280  Valine, leucine and isoleucine degradation
saug00310  Lysine degradation
saug00330  Arginine and proline metabolism
saug00340  Histidine metabolism
saug00380  Tryptophan metabolism
saug00410  beta-Alanine metabolism
saug00561  Glycerolipid metabolism
saug00620  Pyruvate metabolism
saug00625  Chloroalkane and chloroalkene degradation
saug01100  Metabolic pathways
saug01110  Biosynthesis of secondary metabolites
saug01120  Microbial metabolism in diverse environments
saug01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saug00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SA268_0146
   00053 Ascorbate and aldarate metabolism
    SA268_0146
   00620 Pyruvate metabolism
    SA268_0146
  Lipid metabolism
   00071 Fatty acid degradation
    SA268_0146
   00561 Glycerolipid metabolism
    SA268_0146
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SA268_0146
   00310 Lysine degradation
    SA268_0146
   00330 Arginine and proline metabolism
    SA268_0146
   00340 Histidine metabolism
    SA268_0146
   00380 Tryptophan metabolism
    SA268_0146
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SA268_0146
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SA268_0146
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SA268_0146
Enzymes [BR:saug01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SA268_0146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AII54713
LinkDB All DBs
Position
166290..167777
Genome map
AA seq 495 aa AA seqDB search
MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHITRAKDKDVDHAVEVAQ
EAFETWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPIRETTAIDIPFAARHFH
YFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPMLLAAWKIAPAIAAGNTIV
IQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIFNHDGVDKLSFTGSTDVGY
QVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLGILFNQGEVCSAGSRLLVHE
KIYDQLVPRLQEAFSNIKVGDPQDEATQMGSQTGKDQLDKIQSYIDAAKESDAQILAGGH
RLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTVIKVKDDQEAIDIANDSEYGLA
GGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFGGYKKSGIGRETYKGALSNYQQV
KNIYIDTSNALKGLY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaacgttcgagattatattgcagagaattatggtttatttatcaatggggaa
tttgttaaaggtagcagtgacgaaacaatcgaagtgactaatccagcaactggagaaaca
ctatcacatattacaagagcaaaagataaagatgtcgatcatgccgtcgaagtggcgcaa
gaggcatttgaaacatggtcattaacttctaaatcagaacgtgcacaaatgttgcgtgat
attggtgataaattaatggcacaaaaagataaaattgcaatgattgaaacattaaataat
ggtaaaccgattcgtgagacaacagcaattgatattccatttgctgcaagacatttccat
tatttcgcaagtgttattgaaacagaagaaggtacagtgaatgatatcgataaagacaca
atgagtatcgtacgacatgagccgattggcgtcgtaggtgctgttgttgcttggaacttc
ccaatgctattagctgcatggaagattgcgccagccattgctgcaggtaatacaattgtg
attcaaccttcgtcttcaacaccattaagtttattggaagttgctaaaattttccaagag
gtattacctaaaggtgttgtcaatatactaacgggtaaaggttcagaatcaggtaatgca
attttcaatcatgatggtgtagataaattatcatttacgggctcaactgatgtaggttat
caagttgccgaagctgcagcaaagcatctagtacccgctacattagagcttggtggtaaa
agcgccaatatcatattagatgatgctaatttagaccttgcagttgaaggtattcagtta
ggtattttattcaaccaaggtgaagtatgtagtgcaggttctcgattattagttcatgaa
aaaatttatgatcaattggtgccacgtttacaagaggcattttcaaatattaaagttgga
gacccacaagatgaagctacacaaatgggtagtcaaactggtaaggatcaattagataaa
attcaatcatatattgatgcagcaaaagaatcagatgcacaaattttagcaggtggtcat
cgtttaactgaaaatgggttagataaaggattcttctttgaaccgacattaattgctgtg
ccagataatcatcataaattagcgcaagaagaaatatttggaccagttttaacagtgatt
aaagtgaaggacgatcaagaagcaattgatatagctaatgattcagagtatggtttagct
ggcggcgtattttctcaaaatatcacacgtgcattaaatattgctaaagctgttcgtaca
ggacgtatttggattaacacttacaaccaagtaccagaaggcgcaccatttggtggttat
aaaaaatcaggtatcggtcgagaaacttataaaggtgcgttaagtaactatcaacaagtt
aaaaatatttatattgatacaagcaatgctttaaaaggtttgtactag

DBGET integrated database retrieval system