KEGG   Staphylococcus aureus subsp. aureus SA268 (CA-MRSA): SA268_0638Help
Entry
SA268_0638        CDS       T03790                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
saug  Staphylococcus aureus subsp. aureus SA268 (CA-MRSA)
Pathway
saug02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:saug00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SA268_0638
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:saug02000]
    SA268_0638
Transporters [BR:saug02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    SA268_0638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 SMC_N AAA_29 RsgA_GTPase AAA_18 AAA_14 AAA_22 Tmemb_9 AAA_24 Cytidylate_kin AAA_16 MMR_HSR1 Rad17 AAA_33 AAA_28 AAA_23
Motif
Other DBs
NCBI-ProteinID: AII55205
LinkDB All DBs
Position
716281..717954
Genome map
AA seq 557 aa AA seqDB search
MKTRLKFQVDKDLLLAIVVGVCGSLVALAMFFLSGYMVTQSALGAPLYALMILVVTVKLF
GFLRAITRYVERLISHKATFTMLRDIRVQFFGKLVNVIPNVYRKLSSSDLISRMISRVEA
LQNIYLRVYYPPVVIGLTALVTVIVLAFISIGHALLIMVSMLFTLLIVPWLSSKKARTLK
KHAANEQARFLNHFYDYKAGMDELRRFNQINHYRDNLMDKLNHFDKLQLKEQRFLTIYDF
ILNIIAMLSIFGSLVLGLIQINEGQLNIIYMTSIVLMILTLFEQAVPMTNVAYYKADTDQ
ALHDINEVISVPSTNGKNRLNDKYDATNIYEVKDASFKYWNQQTYVLSDINFNVNRGEKI
AIVGPSGSGKSTLLQIMAGLYQLDSGSIRFENMDMFKIDDKDKFESLNVLLQSQQLFDGT
IRQNLFTDEKDEAVQAIFKQLDLEHLALERQIDLDGHTLSGGEIQRLAIARMLLKDTAST
WILDEPTTALDKQNSLKVMDLIEAHAETLIVATHDLTLLSRFETIIVMINGKIVEKGNYQ
QLLANQGALWNMVQYNA
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacgactaaaatttcaagtagataaggatttattgttagctatagttgttggt
gtttgtggaagtttagttgcgctcgccatgtttttcttaagtggttatatggtgacacaa
agtgcacttggtgcgccactatacgctctgatgattttagtcgttacagtaaaattgttt
gggtttttaagagctattactcgatacgtagagcgccttatttctcataaagctacattt
acaatgctacgtgatattcgggtacagtttttcggtaaattagtaaatgtcattcctaat
gtttaccgtaaactgagttctagtgatttaatttcacgtatgattagtcgtgttgaggcg
ttacaaaatatttatttacgtgtttattatccaccagtcgtcatcggtttgacagcgtta
gttacagtaatagtattggcgttcatttcaatcggccatgcgctattgattatggttagc
atgttgtttactttactcatcgttccttggttaagctcaaaaaaagcacgtactttaaag
aaacatgcagctaatgaacaggctcgatttttaaatcatttttatgattataaagctggt
atggatgaactacgtcgatttaatcaaattaatcattatcgagataatttgatggataaa
ttaaatcattttgataaattacaacttaaagagcaacgctttttaacgatttatgatttt
atattaaatattattgctatgctttcgatttttggtagtttagttctgggattaattcaa
attaatgaaggccaactcaatattatttatatgacgagtatagttttaatgatcttaact
ttatttgaacaagctgtaccaatgacaaatgtcgcgtattataaagcggatactgaccaa
gcattgcacgatattaatgaagtgatatctgtaccttctactaatggaaaaaaccgcctt
aatgataagtatgatgcaacgaacatttatgaagttaaggacgctagttttaagtattgg
aaccagcaaacgtatgtgttatcggatattaattttaatgttaatagaggcgaaaagatt
gcgattgtgggtccttctggttcaggaaaaagtacattactacaaattatggcagggtta
tatcaattagatagtggctctattcgtttcgaaaatatggatatgtttaaaatagatgac
aaagataagtttgaatcgctgaatgtcttgctacaatctcaacaattatttgatggtaca
atacgtcaaaatttatttaccgatgaaaaagatgaagcggtgcaagcaatatttaagcaa
ttagatttagaacatttggcactagaacgtcaaattgacttagatggtcatacattatct
ggcggagaaattcagcgtttagcgattgcgaggatgttattaaaagatactgcatcaaca
tggattttagatgaaccaacaacggcattagataaacaaaatagtttaaaagttatggat
ttaattgaagcacatgcagaaacattaattgttgctacacacgatttaactttattgtca
cgttttgagaccatcattgtgatgataaatggtaaaatagttgaaaagggaaactatcaa
caattactcgctaatcaaggtgctttatggaatatggttcaatataatgcataa

DBGET integrated database retrieval system