KEGG   Staphylococcus aureus subsp. aureus SA268 (CA-MRSA): SA268_1037Help
Entry
SA268_1037        CDS       T03790                                 

Gene name
sdhA
Definition
(GenBank) putative succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
saug  Staphylococcus aureus subsp. aureus SA268 (CA-MRSA)
Pathway
saug00020  Citrate cycle (TCA cycle)
saug00190  Oxidative phosphorylation
saug00650  Butanoate metabolism
saug01100  Metabolic pathways
saug01110  Biosynthesis of secondary metabolites
saug01120  Microbial metabolism in diverse environments
saug01130  Biosynthesis of antibiotics
saug01200  Carbon metabolism
Module
saug_M00009  Citrate cycle (TCA cycle, Krebs cycle)
saug_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:saug00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SA268_1037 (sdhA)
   00650 Butanoate metabolism
    SA268_1037 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SA268_1037 (sdhA)
Enzymes [BR:saug01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SA268_1037 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     SA268_1037 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like GIDA FAD_oxidored AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AII55604
LinkDB All DBs
Position
1126113..1127879
Genome map
AA seq 588 aa AA seqDB search
MAEKHLIVVGGGLAGLMSTIKAAEKGAHVDLFSVVPVKRSHSVCAQGGINGAVNTKGEGD
SPWIHFDDTVYGGDFLANQPPVKAMTEAAPKIIHLLDRMGVMFNRTNEGLLDFRRFGGTL
HHRTAYAGATTGQQLLYALDEQVRAYEVDGLVTKYEGWEFLGIVKGDDDSARGIVAQNMT
TAEIETFGSDAVIMATGGPGIIFGKTTNSMINTGSAASIVYQQGAIYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCINQK
LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYV
DYDQMTNIKGLFAAGECDFSQHGGNRLGANSLLSAIYGGTVAGPNAIEYISNIDRSYTDM
DESIFEKRKAEEQERFDKLLAMRGTENAYKLHRELGEIMTANVTVVRENEKLLETDKKIV
ELMKRYEDIDMEDTQTWSNQAVFFTRQLWNMLVLARVITIGAYNRNESRGAHYKPEFPER
NDEEWLKTTMASFQGAFEKPQFTYDDVDVSLIPPRKRDYTSKSKGGKK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacatcttattgttgtcggaggtggcctagcgggcttaatgtcaacaatt
aaagcggcagaaaaaggtgcacatgtagatttattctcagttgtaccagtaaagcgttcg
cactctgtttgtgcccaaggtggcattaatggtgcggtcaatactaaaggggaaggcgat
tctccttggattcactttgatgatacagtgtatggtggcgacttccttgcaaaccaacca
cctgttaaagcgatgacagaggcagcacctaaaattattcatttattagaccgtatgggc
gtaatgttcaatagaacaaatgaaggtctattagattttagacgtttcggtggtacatta
caccacagaacagcatatgcaggggcaacaactggacaacaattattatatgcattggat
gaacaagttcgtgcatatgaagtagatggattagttacgaagtatgaaggatgggaattc
cttggcatagttaaaggtgacgatgatagtgcaagaggtatcgttgcacaaaatatgaca
actgctgagattgaaacatttggatcagatgcagttattatggcaacgggtggccctggt
attattttcggtaaaacaacaaactcaatgattaatacaggatcagcggcttccattgtt
taccaacaaggcgctatttatgctaatggtgagttcattcaaattcatcctactgcaata
cctggtgatgataaactacgactaatgagtgaatcagcacgtggtgaaggtggacgaatt
tggacatataaagatggtaagccttggtacttcttagaagagaaatatcctgattatggt
aacttagtacctcgtgatatcgcaacgcgtgaaattttcgatgtatgtattaaccaaaaa
ttaggtattaatggcgaaaacatggtatatcttgatttgtcacataaagatccacatgag
ttagatgtcaaactaggtggtatcattgaaatttatgaaaaattcactggtgatgaccca
cgcaaagtaccaatgaagattttcccagctgtccactattcaatgggtggtctatatgta
gattatgatcaaatgacaaatattaaagggttatttgcagctggagaatgtgacttctct
caacatggtggtaaccgcttaggtgccaattcattgttatcagcgatttatggtggtaca
gtagcaggtccaaacgcgattgagtatatttcaaatattgatcgatcatatactgatatg
gacgaaagtatttttgaaaaacgtaaagctgaagagcaagaacgttttgataaattatta
gctatgcgcggtacagaaaatgcatataaattacaccgtgaacttggtgaaattatgaca
gcaaatgtaactgttgttcgtgaaaatgaaaaactgttagaaacagataaaaagattgtt
gaattgatgaaacgttatgaagatattgatatggaagatactcaaacttggagtaaccaa
gcggtattctttactcgtcaattatggaacatgttagtacttgcacgtgttattacgatt
ggtgcatataaccgtaacgaatcacgcggtgcccattataaaccagaattcccagagcgt
aatgatgaagagtggttaaaaacgacaatggcctcattccaaggcgcatttgaaaaacca
cagtttacttatgatgacgtcgatgtgagtttaataccacctcgtaaacgtgattacaca
agtaagtctaaagggggtaaaaaataa

DBGET integrated database retrieval system