KEGG   Staphylococcus aureus subsp. aureus SA268 (CA-MRSA): SA268_1038Help
Entry
SA268_1038        CDS       T03790                                 

Gene name
sdhB
Definition
(GenBank) putative succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
saug  Staphylococcus aureus subsp. aureus SA268 (CA-MRSA)
Pathway
saug00020  Citrate cycle (TCA cycle)
saug00190  Oxidative phosphorylation
saug00650  Butanoate metabolism
saug01100  Metabolic pathways
saug01110  Biosynthesis of secondary metabolites
saug01120  Microbial metabolism in diverse environments
saug01130  Biosynthesis of antibiotics
saug01200  Carbon metabolism
Module
saug_M00009  Citrate cycle (TCA cycle, Krebs cycle)
saug_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:saug00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SA268_1038 (sdhB)
   00650 Butanoate metabolism
    SA268_1038 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SA268_1038 (sdhB)
Enzymes [BR:saug01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SA268_1038 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     SA268_1038 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_9 Fer4_10 Fer4_17 Fer4_2 Fer4_16 Fer4_15 Fer4 Fer4_13 Fer4_21 Fer4_6 Fer4_4 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AII55605
LinkDB All DBs
Position
1127879..1128694
Genome map
AA seq 271 aa AA seqDB search
MTEQSVKNTPQHETQSKPKQKTVKLIIKRQDTSDSKPYEETFEIPYRENLNVIACLMEIR
RNPVNIKGEKTTPVVWDMNCLEEVCGACSMVINGRARQSCSAIVDQLEQPIRLEPMNTFP
VIRDLQVDRSRMFDNLKRMKAWIPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEV
CPNVTENNKFVGAQAISQVRLFNLHPTGSMTKDERLNALMGTGGLQQCGNSQNCVNACPK
GIPLTTSIAAMNRETTFHMFKSFFGSDHEVE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaatcagtgaaaaacactccacaacatgaaacacaatctaaaccgaaacaa
aaaacagtaaaattaattattaaacgacaagatacaagtgattctaagccttatgaagaa
acatttgaaattccatatcgtgaaaatttaaacgtcattgcatgtttaatggaaattaga
cgtaacccagtgaatattaaaggtgaaaaaacaacacctgttgtctgggatatgaactgt
ttagaagaagtatgtggagcatgttctatggttatcaatggtcgtgcaagacaatcttgt
tctgcgattgttgatcaattagaacaacctattcgtttagagccaatgaatactttccca
gttatccgtgacttacaagttgatcgttctagaatgttcgataacttaaaacgtatgaaa
gcatggatcccaatcgatggaacgtatgatttaggtccgggaccacgtatgccagagaaa
aaacgtcaaacagcttatgaattatctaaatgtatgacatgtggtgtatgtttagaagtt
tgtcctaatgttactgaaaataataaatttgttggtgcgcaagcaatctcgcaagttcgt
ttgtttaatttgcacccaacaggatctatgactaaggatgaacgtttaaatgcgttaatg
ggtacaggtggcttacagcaatgtggtaattcacaaaactgtgttaatgcttgccctaaa
ggtattccattaacaacatccattgcagcaatgaacagagaaacaacattccatatgttt
aaatcattctttggttcagaccatgaagtagaataa

DBGET integrated database retrieval system