KEGG   Staphylococcus aureus USA300-ISMMS1 (MRSA): AZ30_01245Help
Entry
AZ30_01245        CDS       T03115                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
saui  Staphylococcus aureus USA300-ISMMS1 (MRSA)
Pathway
saui00040  Pentose and glucuronate interconversions
saui00051  Fructose and mannose metabolism
saui01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AZ30_01245
   00051 Fructose and mannose metabolism
    AZ30_01245
Enzymes [BR:saui01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     AZ30_01245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 NAD_binding_3 AdoHcyase_NAD ADH_N_2 UDPG_MGDP_dh_N TrkA_N adh_short_C2 CHASE4
Motif
Other DBs
NCBI-ProteinID: AHJ06058
LinkDB All DBs
Position
292432..293487
Genome map
AA seq 351 aa AA seqDB search
MKALVKTREGHGNLELLDKEVATPLDDKVKIKVHYAGICGTDIHTYEGHYKVNFPVTLGH
EFSGEIVEVGADVKDFKVGDRVTSETTFYVCNECEYCKSKDYNLCNHRKGIGTQVDGAFT
NYVIAREESLHHIPDEVSYQSAAMTEPLACAYHGVSKIQVNSGDVAVVMGPGPIGLLVAQ
VLKSKGATVVVTGLDNDKVRLDKAEALHMDYVVNLQQTDLKTYINGITDGYGADVVVECS
GAVPAARQGLDILRKKGFYSQIGIFKDAEIPFDMEKVIQKEITVVGSRSQKPADWEPSLQ
LMADGLVNAEALVTKIYDISKWDEAYQHLKSGEGIKVLLKPLDLDENEGEN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctttagtaaaaacaagagaaggacatggcaacttagaacttcttgataaagaa
gttgcaacaccgctagatgataaagtaaagattaaagtacattatgcaggaatttgtggc
acagatattcatacttatgaaggtcattataaagttaattttccagtgacattaggtcat
gaattttctggtgaaatcgttgaagttggagcagacgttaaagattttaaagttggtgac
cgtgtcacatctgaaacgacattctatgtttgtaatgagtgtgaatactgtaaatcaaaa
gactataatttatgcaaccatcgaaaaggtattggaacacaagttgatggcgcatttact
aattatgtcattgcacgtgaagaaagtttgcatcatattccagacgaagtatcgtatcag
tctgcagctatgacagaaccattagcatgtgcatatcatggcgtttctaagattcaagtc
aattcaggcgatgtagcagttgtaatgggacctgggccaatcggattacttgtagcacaa
gtgttaaaaagtaaaggcgcaactgttgtggtaactggattggacaatgacaaagtcaga
ttagataaagcagaagcattgcacatggattatgtagtcaatttacaacaaacagactta
aaaacgtatatcaatggaattacagacggttacggtgcagatgttgttgttgaatgttca
ggtgcagttccagcagcacgacaaggtttggatattttacgcaaaaaaggtttctacagt
caaataggtatttttaaggatgctgaaattccatttgatatggaaaaagtgattcaaaaa
gaaataacagttgttggtagtagaagtcaaaagccagcagattgggaaccttcattgcaa
cttatggcggatggtttagtaaatgctgaagctttggtgacaaaaatatatgatatttcg
aaatgggacgaggcgtatcaacatttaaaatccggcgaaggtattaaagtattacttaag
ccgctcgatttagatgaaaatgaaggagagaattaa

DBGET integrated database retrieval system