KEGG   Staphylococcus aureus USA300-ISMMS1 (MRSA): AZ30_05490Help
Entry
AZ30_05490        CDS       T03115                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
saui  Staphylococcus aureus USA300-ISMMS1 (MRSA)
Pathway
saui00020  Citrate cycle (TCA cycle)
saui00190  Oxidative phosphorylation
saui00650  Butanoate metabolism
saui01100  Metabolic pathways
saui01110  Biosynthesis of secondary metabolites
saui01120  Microbial metabolism in diverse environments
saui01130  Biosynthesis of antibiotics
saui01200  Carbon metabolism
Module
saui_M00009  Citrate cycle (TCA cycle, Krebs cycle)
saui_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:saui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AZ30_05490 (sdhA)
   00650 Butanoate metabolism
    AZ30_05490 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AZ30_05490 (sdhA)
Enzymes [BR:saui01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AZ30_05490 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     AZ30_05490 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AHJ06873
LinkDB All DBs
Position
1165175..1166941
Genome map
AA seq 588 aa AA seqDB search
MAEKHLIVVGGGLAGLMSTIKAAEKGAHVDLFSVVPVKRSHSVCAQGGINGAVNTKGEGD
SPWIHFDDTVYGGDFLANQPPVKAMTEAAPKIIHLLDRMGVMFNRTNEGLLDFRRFGGTL
HHRTAYAGATTGQQLLYALDEQVRAYEVDGLVTKYEGWEFLGIVKGDDDSARGIVAQNMT
TAEIETFGSDAVIMATGGPGIIFGKTTNSMINTGSAASIVYQQGAIYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCINQK
LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYV
DYDQMTNIKGLFAAGECDFSQHGGNRLGANSLLSAIYGGTVAGPNAIDYISNIDRSYTDM
DESIFEKRKAEEQERFDKLLAMRGTENAYKLHRELGEIMTANVTVVRENEKLLETDKKIV
ELMKRYEDIDMEDTQTWSNQAVFFTRQLWNMLVLARVITIGAYNRNESRGAHYKPEFPER
NDEEWLKTTMASFQGAFEKPQFTYDDVDVSLIPPRKRDYTSKSKGGKK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacatcttattgttgtcggaggtggcctagcgggcttaatgtcaacaatt
aaagcggcagaaaaaggtgcacatgtagatttgttctcagttgtaccagtaaagcgttcg
cactctgtttgtgcccaaggtggcattaatggtgcggtcaatactaaaggggaaggcgat
tctccttggattcactttgatgatacagtgtatggtggcgatttccttgcaaaccaacca
cctgttaaagcgatgacagaggcagcacctaaaattattcatttattagaccgtatgggc
gtaatgttcaatagaacaaatgaaggtctattagattttagacgtttcggtggtacatta
catcacagaacagcatatgcaggggcaacaactggacaacaattattatatgcattggat
gaacaagttcgtgcatatgaagtagatggattagttacgaagtatgaaggatgggaattc
cttggcatagttaaaggtgacgatgatagtgcaagaggtatcgttgcacaaaatatgaca
actgctgagattgaaacatttggttcagatgcagttattatggcaacgggtggccctggt
attattttcggtaaaacaacaaactcaatgattaatacaggatcagcggcttccattgtt
taccaacaaggcgctatttatgctaatggtgagttcattcaaattcatcctactgcaatc
cctggtgatgataaactgcgactaatgagtgaatcagcacgtggtgaaggtggacgaatt
tggacatataaagatggtaagccttggtacttcttagaagagaaatatcctgattatggt
aacttagtacctcgtgatatcgcaacgcgtgaaattttcgatgtatgtattaaccaaaaa
ttaggtataaatggcgaaaacatggtatatcttgatttgtcacataaagatccacatgag
ttagatgtaaaactaggtggtatcattgagatttatgaaaaattcactggtgatgaccca
cgcaaagtaccaatgaagattttcccagctgttcactattcaatgggtggtctatatgta
gattatgatcaaatgacaaatattaaagggttatttgcagctggagaatgtgacttctct
caacatggtggtaaccgcttaggtgccaattcattgttatcagcgatttatggtggtaca
gtagcaggtccaaacgcgattgattatatttcaaatattgatcgatcatatactgatatg
gacgaaagtatttttgaaaagcgtaaagctgaagagcaagaacgttttgataaattatta
gctatgcgcggtacagaaaatgcatataaattacaccgtgaacttggtgaaattatgaca
gcaaatgtaactgttgttcgtgaaaatgaaaaactgttagaaacagataaaaagattgtt
gaattgatgaaacgttatgaagatattgatatggaagatactcaaacttggagtaaccaa
gcggtattctttacccgtcaactatggaacatgttagtacttgcacgtgttattacgatt
ggtgcatataaccgtaacgaatcacgcggtgcccattataaaccagaattcccagagcgt
aatgatgaagagtggttaaaaacgacaatggcctcattccaaggcgcatttgaaaaaccg
cagtttacttatgatgacgtcgatgtgagtttaataccacctcgtaaacgtgattacaca
agtaagtctaaagggggtaaaaaataa

DBGET integrated database retrieval system