KEGG   Staphylococcus aureus USA300-ISMMS1 (MRSA): AZ30_05495Help
Entry
AZ30_05495        CDS       T03115                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
saui  Staphylococcus aureus USA300-ISMMS1 (MRSA)
Pathway
saui00020  Citrate cycle (TCA cycle)
saui00190  Oxidative phosphorylation
saui00650  Butanoate metabolism
saui01100  Metabolic pathways
saui01110  Biosynthesis of secondary metabolites
saui01120  Microbial metabolism in diverse environments
saui01130  Biosynthesis of antibiotics
saui01200  Carbon metabolism
Module
saui_M00009  Citrate cycle (TCA cycle, Krebs cycle)
saui_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:saui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AZ30_05495 (sdhB)
   00650 Butanoate metabolism
    AZ30_05495 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AZ30_05495 (sdhB)
Enzymes [BR:saui01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AZ30_05495 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     AZ30_05495 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_9 Fer4_10 Fer4_17 Fer4_2 Fer4_16 Fer4_15 Fer4 Fer4_13 Fer4_21 Fer4_6 Fer4_4 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AHJ06874
LinkDB All DBs
Position
1166941..1167756
Genome map
AA seq 271 aa AA seqDB search
MTEQSVKNTPQHETQSKPKQKTVKLIIKRQDTSDSKPYEETFEIPYRENLNVIACLMEIR
RNPVNIKGEKTTPVVWDMNCLEEVCGACSMVINGRARQSCSAIVDQLEQPIRLEPMNTFP
VIRDLQVDRSRMFDNLKRMKAWIPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEV
CPNVTENNKFVGAQAISQVRLFNLHPTGSMTKDERLNALMGTGGLQQCGNSQNCVNACPK
GIPLTTSIAAMNRETTFHMFKSFFGSDHEVE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaatcagtgaaaaacactccacaacatgaaacacaatctaaaccgaaacaa
aaaacagtaaaattaattattaaacgacaagatacaagtgattctaagccttatgaagaa
acatttgaaattccatatcgtgaaaatttaaacgtcattgcttgtttaatggaaattaga
cgtaacccagttaatattaaaggtgaaaaaacaacacctgttgtctgggatatgaactgc
ttagaagaagtatgtggagcatgttctatggttatcaatggtcgtgcaagacaatcttgt
tctgcgattgttgatcaattagaacaacctattcgtttagagccaatgaatactttccca
gttatccgtgacttacaagttgatcgttctagaatgttcgataacttaaaacgtatgaaa
gcatggatcccaattgatggaacgtatgatttaggtccgggaccacgtatgccagagaaa
aaacgtcaaacagcttatgaattatctaaatgtatgacatgtggtgtatgtttagaggtt
tgtcctaatgttactgaaaataataaattcgttggtgcacaagcaatctcgcaagttcgt
ttgtttaatttgcacccaacaggatctatgactaaagatgaacgtttaaatgcattaatg
ggtactggtggcttacagcagtgtggtaattcacaaaactgtgttaatgcttgccctaaa
ggtattccattaacaacatccattgcagcaatgaacagagaaacaacattccacatgttt
aaatcattctttggttcagaccatgaagtagaataa

DBGET integrated database retrieval system