KEGG   Staphylococcus aureus USA300-ISMMS1 (MRSA): AZ30_11205Help
Entry
AZ30_11205        CDS       T03115                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
saui  Staphylococcus aureus USA300-ISMMS1 (MRSA)
Pathway
saui00010  Glycolysis / Gluconeogenesis
saui00053  Ascorbate and aldarate metabolism
saui00071  Fatty acid degradation
saui00280  Valine, leucine and isoleucine degradation
saui00310  Lysine degradation
saui00330  Arginine and proline metabolism
saui00340  Histidine metabolism
saui00380  Tryptophan metabolism
saui00410  beta-Alanine metabolism
saui00561  Glycerolipid metabolism
saui00620  Pyruvate metabolism
saui00625  Chloroalkane and chloroalkene degradation
saui01100  Metabolic pathways
saui01110  Biosynthesis of secondary metabolites
saui01120  Microbial metabolism in diverse environments
saui01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZ30_11205
   00053 Ascorbate and aldarate metabolism
    AZ30_11205
   00620 Pyruvate metabolism
    AZ30_11205
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AZ30_11205
   00561 Glycerolipid metabolism
    AZ30_11205
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZ30_11205
   00310 Lysine degradation
    AZ30_11205
   00330 Arginine and proline metabolism
    AZ30_11205
   00340 Histidine metabolism
    AZ30_11205
   00380 Tryptophan metabolism
    AZ30_11205
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AZ30_11205
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AZ30_11205
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AZ30_11205
Enzymes [BR:saui01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AZ30_11205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHJ07944
LinkDB All DBs
Structure
PDB: 

Position
complement(2286786..2288213)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADDVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatacattaatggcgaatgggtagaaagtaatagtaatgaa
acgatagaagttataaatccagcaaccgaagaagtaatcgggaaagttgctaaaggtaat
aaagctgatgttgataaagccgtcgaggcggcagacgatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagcgttattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgaattaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaaccattttgttgcagcgagagacgcattagataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagcaatcggtgtatct
ggattaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcagcagca
tttgcggctggtagtccagttgtacttaaaccatctgaagaaacaccatttgcagctgtt
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctggtgttgggaatcctttatctgaacatcctaaagtacgcatgatgtca
tttacaggatcaggccctactggttctaaaattatggaaaaagccgctaaagattttaaa
aaggtatcattagagcttggtggcaaatcaccatatatcgtcctagatgacgtagatatt
aaagaagcggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctaacaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcggtaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagaa
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtagataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcagttatcacttataacgatttagatgaagcgattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gatttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggatattttaaataa

DBGET integrated database retrieval system