KEGG   Staphylococcus aureus subsp. aureus ST228/10497 (MRSA): SAI2T2_1001200Help
Entry
SAI2T2_1001200    CDS       T03144                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sauj  Staphylococcus aureus subsp. aureus ST228/10497 (MRSA)
Pathway
sauj00010  Glycolysis / Gluconeogenesis
sauj00053  Ascorbate and aldarate metabolism
sauj00071  Fatty acid degradation
sauj00280  Valine, leucine and isoleucine degradation
sauj00310  Lysine degradation
sauj00330  Arginine and proline metabolism
sauj00340  Histidine metabolism
sauj00380  Tryptophan metabolism
sauj00410  beta-Alanine metabolism
sauj00561  Glycerolipid metabolism
sauj00620  Pyruvate metabolism
sauj00625  Chloroalkane and chloroalkene degradation
sauj01100  Metabolic pathways
sauj01110  Biosynthesis of secondary metabolites
sauj01120  Microbial metabolism in diverse environments
sauj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sauj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAI2T2_1001200
   00053 Ascorbate and aldarate metabolism
    SAI2T2_1001200
   00620 Pyruvate metabolism
    SAI2T2_1001200
  Lipid metabolism
   00071 Fatty acid degradation
    SAI2T2_1001200
   00561 Glycerolipid metabolism
    SAI2T2_1001200
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAI2T2_1001200
   00310 Lysine degradation
    SAI2T2_1001200
   00330 Arginine and proline metabolism
    SAI2T2_1001200
   00340 Histidine metabolism
    SAI2T2_1001200
   00380 Tryptophan metabolism
    SAI2T2_1001200
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAI2T2_1001200
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAI2T2_1001200
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAI2T2_1001200
Enzymes [BR:sauj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAI2T2_1001200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: CCJ12065
LinkDB All DBs
Position
161029..162516
Genome map
AA seq 495 aa AA seqDB search
MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQ
EAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPIRETTAIDIPFAARHFH
YFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPMLLAAWKIAPAIAAGNTIV
IQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIFNHDGVDKLSFTGSTDVGY
QVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLGILFNQGEVCSAGSRLLVHE
KIYDQLVPRLQEAFSNIKVGDPQDEATQMGSQTGKDQLDKIQSYIDAAKESDAQILAGGH
RLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTVIKVKDDQEAIDIANDSEYGLA
GGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFGGYKKSGIGRETYKGALSNYQQV
KNIYIDTSNALKGLY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaacgttcgagattatattgcagagaattatggtttatttatcaatggggaa
tttgttaaaggtagcagtgacgaaacaatcgaagtgactaatccagcaactggagaaaca
ctatcacatattacaagagcaaaagataaagatgtcgatcatgcagtcaaagtggcgcaa
gaggcatttgaatcatggtcattaacttctaaatcagaacgtgcacaaatgttgcgtgat
attggtgataaattaatggcacaaaaagataaaattgcaatgattgaaacattaaataat
ggtaaaccgattcgtgagacaacagcaattgatattccatttgctgcaagacatttccat
tatttcgcaagtgttattgaaacagaagaaggtacagtaaatgatatcgataaagacaca
atgagtatcgtacgacatgagccgattggcgtcgtaggtgctgttgttgcttggaacttc
ccaatgctattagctgcatggaagattgcgccagccattgctgcaggtaatacaattgtg
attcaaccttcgtcttcaacaccattaagtttattggaagttgctaaaattttccaagag
gtattacctaaaggtgttgtcaatatactaacgggtaaaggttcagaatcaggtaatgca
attttcaatcatgatggtgtagataaattatcatttacgggctcaactgatgtaggttat
caagttgccgaagctgcagcaaaacatctagtacccgctacattagagcttggtggtaaa
agcgccaatatcatattagatgatgctaatttagaccttgcagttgaaggtattcagtta
ggtattttattcaaccaaggtgaagtatgtagtgcaggttctcgattattagttcatgaa
aaaatttatgatcaattggtgccacgtttacaagaggcattttcaaatattaaagttgga
gatccacaagatgaagctacacaaatgggtagtcaaactggtaaggatcaattagataaa
attcaatcatatattgatgcagcaaaagaatcagatgcacaaattttagcaggtggtcat
cgcttaactgaaaatggattagataaagggttcttctttgagccgacattaattgctgtg
ccagacaatcatcacaaattagcacaagaagaaatatttggaccagtgttaacagtgatt
aaagtgaaggacgatcaagaagcaattgatatagctaatgattctgagtatggtttagca
ggcggtgtattttctcaaaatatcacacgtgcattaaatattgctaaagctgtacgtaca
ggacgtatttggattaacacttacaaccaagtaccagaaggcgcaccatttggtggttat
aaaaaatcaggtatcggtcgagaaacttataaaggtgcgttaagtaactatcaacaagtt
aaaaatatttatattgatacaagcaatgctttaaaaggtttgtactag

DBGET integrated database retrieval system