KEGG   Staphylococcus aureus subsp. aureus ST228/10497 (MRSA): SAI2T2_1001900Help
Entry
SAI2T2_1001900    CDS       T03144                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sauj  Staphylococcus aureus subsp. aureus ST228/10497 (MRSA)
Pathway
sauj00040  Pentose and glucuronate interconversions
sauj00051  Fructose and mannose metabolism
sauj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sauj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SAI2T2_1001900
   00051 Fructose and mannose metabolism
    SAI2T2_1001900
Enzymes [BR:sauj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SAI2T2_1001900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 AdoHcyase_NAD NAD_binding_3 ADH_N_2 UDPG_MGDP_dh_N TrkA_N adh_short_C2 CHASE4
Motif
Other DBs
NCBI-ProteinID: CCJ12135
LinkDB All DBs
Position
265956..267020
Genome map
AA seq 354 aa AA seqDB search
MFVVKALVKTREGHGNLELLDKEVATPLDDKVKIKVHYAGICGTDIHTYEGHYKVNFPVT
LGHEFSGEIVEVGADVKDFKVGDRVTSETTFYVCNECEYCKSKDYNLCNHRKGIGTQVDG
AFTNYVIAREESLHHIPDEVSYQSAAMTEPLACAHHGVSKIQVNSGDVAVVMGPGPIGLL
VAQVLKSKGATVVVTGLDNDKVRLDKAEALHMDYVVNLQQTDLKTYINGITDGYGADVVV
ECSGAVPAARQGLDIIRKKGFYSQIGIFKDAEIPFDMEKVIQKEITVVGSRSQKPADWEP
SLQLMADGLVNAEALVTKIYDISKWDEAYQHLKSGEGIKALLKPLDLDENEGEN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgtggtgaaagctttagtaaaaacaagagaaggacatggcaacttagaacttctt
gataaagaagttgcaacaccgctagatgataaagtaaagattaaagtacattatgcagga
atttgtggcacagacattcatacttatgaagggcattataaagttaattttccagtgaca
ttaggtcatgaattttctggtgaaatcgttgaagttggagcagacgttaaagattttaaa
gttggtgaccgtgtcacttctgaaactacattctatgtttgtaatgagtgtgaatactgt
aaatcaaaagactataatttatgcaaccatcgaaaaggtattggaacacaagttgatggc
gcatttactaattatgtcattgcacgtgaagaaagtttgcatcatattccagacgaagta
tcgtatcagtctgcagctatgacagaaccattagcatgtgcacatcatggcgtttctaag
attcaagtgaactctggcgatgtagcagttgtaatgggacctgggccaatcggattactt
gtagcacaagtgttgaaaagtaaaggcgcaactgttgtggtaactggattggacaatgac
aaagtcagattagataaagcagaagcattgcacatggattatgtagtcaatttacaacaa
acagacttaaaaacgtatatcaatggaattacagacggttacggtgcagatgttgttgtt
gaatgttcaggtgcagttccagcagcacgacaaggtttagatattatacgcaaaaaaggt
ttctacagtcaaataggtatttttaaggatgctgaaattccatttgatatggaaaaagtg
attcaaaaagaaataacagttgttggtagtagaagtcaaaagccagcagattgggaacct
tcattgcaacttatggcggatggtttagtaaatgctgaagctttggtgacaaaaatatat
gatatttcgaaatgggacgaggcgtatcaacatttaaaatctggcgaaggtattaaagca
ttacttaagccgctcgatttagatgaaaatgaaggagagaattaa

DBGET integrated database retrieval system