KEGG   Staphylococcus aureus subsp. aureus ST228/15532 (MRSA): SAI3T3_1008700Help
Entry
SAI3T3_1008700    CDS       T03145                                 

Definition
(GenBank) Protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sauk  Staphylococcus aureus subsp. aureus ST228/15532 (MRSA)
Brite
KEGG Orthology (KO) [BR:sauk00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sauk01001]
    SAI3T3_1008700
Enzymes [BR:sauk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SAI3T3_1008700
Protein kinases [BR:sauk01001]
 Serine/threonine kinases: Other
  Bacterial family
   SAI3T3_1008700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Seadorna_VP7 RIO1 Choline_kinase ChlamPMP_M Sigma_reg_N ETRAMP Kdo Kinase-like PNPase
Motif
Other DBs
NCBI-ProteinID: CCJ14759
LinkDB All DBs
Structure
PDB: 

Position
1180941..1182875
Genome map
AA seq 644 aa AA seqDB search
MSTVYLAEDTILNIKVAIKAIFIPPREKEETLKRFEREVHNSSQLSHQNIVSMIDVDEED
DCYYLVMEYIEGPTLSEYIESHGPLSVDTAINFTNQILDGIKHAHDMRIVHRDIKPQNIL
IDSNKTLKIFDFGIAKALSETSLTQTNHVLGTVQYFSPEQAKGEATDECTDIYSIGIVLY
EMLVGEPPFNGETAVSIAIKHIQDSVPNVTTDVRKDIPQSLSNVILRATEKDKANRYKTI
QEMKDDLSSVLHENRANEDVYELDKMKTIAVPLKKEDLAKHISEHKSNQPKRETTQVPIV
NGPAHHQQFQKPEGTVYEPKPKKKSTRKIVLLSLIFSLLMIALVSFVAMAMFGNKYEETP
DVIGKSVKEAEQIFNKNNLKLGKISRSYSDKYPENEIIKTTPNTGERVERGDSVDVVISK
GPEKVKMPNVIGLPKEEALQKLKSLGLKDVTIEKVYNNQAPKGYIANQSVTANTEIAIHD
SNIKLYESLGIKQVYVEDFEHKSFSKAKKALEEKGFKVESKEEYSDDIDEGDVISQSPKG
KSVDEGSTISFVVSKGKKSDSSDVKTTTESVDVPYTGKNDKSQKVKVYIKDKDNDGSTEK
GSFDITSDQRIDIPLRIEKGKTASYIVKVDGKTVAEKEVSYDDI
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgtttatcttgcagaagatacgatacttaacattaaagttgcaattaaggcg
atttttataccacctagagaaaaagaagaaacattaaaacgttttgaacgagaagtacat
aactcatcacagctatcacatcaaaatatagtaagtatgatcgatgttgatgaagaagat
gactgttactacttagtaatggaatatattgaaggtccgactttgtctgagtatattgaa
agtcatgggccattaagtgttgacacggcgattaattttacgaatcaaatattggatggc
attaaacatgcgcatgatatgcgtattgtacatagagatattaagccacaaaatatatta
attgacagcaataaaacgttgaaaatatttgattttggaattgctaaagctttaagtgag
acgtctttaactcagactaatcatgtgttaggtactgtgcagtacttttcgccagaacaa
gcaaaaggtgaggcaacggatgaatgtacagatatttattctataggtattgtgttatat
gaaatgcttgttggtgaaccaccctttaatggagaaactgcagttagcattgcgattaaa
catattcaggattctgtgccaaatgtgacaacagatgtacgtaaggatattccgcaatct
ttaagtaatgtcattttacgcgctacagaaaaagacaaagcgaatcgttacaaaacaatt
caagaaatgaaagatgatttgagtagtgttttacatgaaaatcgagcgaatgaagatgtc
tatgaactcgataaaatgaaaacgatagcggtacctttgaaaaaagaagatctagcaaag
catattagtgaacataagtcgaatcaacctaaacgtgaaacgacgcaagtacctattgta
aatgggcctgctcatcatcagcaattccaaaagccagaaggtacggtgtacgaaccaaaa
cctaaaaagaaatcaacacgaaagattgtgctcttatcactaatcttttcgttgttaatg
attgcacttgtttcttttgtggcaatggcaatgtttggtaataaatacgaagagacacct
gatgtaatcgggaaatctgtaaaagaagcagagcaaatattcaataaaaacaacctgaaa
ttgggtaaaatttctagaagttatagtgataaatatcctgaaaatgaaattattaagaca
actcctaatactggtgaacgtgttgaacgtggtgacagtgttgatgttgttatatcaaag
ggccctgaaaaggttaaaatgccaaatgtcattggtttacctaaggaggaagcattgcag
aaattaaaatcgttaggtcttaaagatgttacgattgaaaaagtatataataatcaagcg
ccaaaaggatacattgcaaatcaaagtgtaaccgcaaatactgaaatcgctattcatgat
tctaatattaaactatatgaatctttaggcattaagcaagtttatgtagaagactttgag
cataaatcctttagcaaagctaaaaaagccttagaagaaaaagggtttaaagttgaaagt
aaggaagagtatagtgacgatattgatgagggtgatgtgatttctcaatctcctaaagga
aaatcagtagatgaggggtcaacgatttcatttgttgtttctaaaggtaaaaaaagtgac
tcatcagatgtcaaaacgacaactgaatcggtagatgtaccatacactggtaaaaatgat
aagtcacaaaaagttaaagtttatattaaagataaagataatgacggttcaactgaaaaa
ggtagtttcgacattactagtgatcaacgtatagacattcctttaagaattgaaaaagga
aaaacagcaagttatattgttaaagttgacggtaaaactgtagctgaaaaagaagtcagc
tatgatgatatttaa

DBGET integrated database retrieval system