KEGG   Staphylococcus aureus subsp. aureus ST228/15532 (MRSA): SAI3T3_1015630Help
Entry
SAI3T3_1015630    CDS       T03145                                 

Gene name
aldA
Definition
(GenBank) Aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sauk  Staphylococcus aureus subsp. aureus ST228/15532 (MRSA)
Pathway
sauk00010  Glycolysis / Gluconeogenesis
sauk00053  Ascorbate and aldarate metabolism
sauk00071  Fatty acid degradation
sauk00280  Valine, leucine and isoleucine degradation
sauk00310  Lysine degradation
sauk00330  Arginine and proline metabolism
sauk00340  Histidine metabolism
sauk00380  Tryptophan metabolism
sauk00410  beta-Alanine metabolism
sauk00561  Glycerolipid metabolism
sauk00620  Pyruvate metabolism
sauk00625  Chloroalkane and chloroalkene degradation
sauk01100  Metabolic pathways
sauk01110  Biosynthesis of secondary metabolites
sauk01120  Microbial metabolism in diverse environments
sauk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sauk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAI3T3_1015630 (aldA)
   00053 Ascorbate and aldarate metabolism
    SAI3T3_1015630 (aldA)
   00620 Pyruvate metabolism
    SAI3T3_1015630 (aldA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAI3T3_1015630 (aldA)
   00561 Glycerolipid metabolism
    SAI3T3_1015630 (aldA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAI3T3_1015630 (aldA)
   00310 Lysine degradation
    SAI3T3_1015630 (aldA)
   00330 Arginine and proline metabolism
    SAI3T3_1015630 (aldA)
   00340 Histidine metabolism
    SAI3T3_1015630 (aldA)
   00380 Tryptophan metabolism
    SAI3T3_1015630 (aldA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAI3T3_1015630 (aldA)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAI3T3_1015630 (aldA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAI3T3_1015630 (aldA)
Enzymes [BR:sauk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAI3T3_1015630 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CCJ15410
LinkDB All DBs
Structure
PDB: 

Position
complement(2122660..2124087)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADDVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatacattaatggcgaatgggtagaaagtaatagtaatgaa
acgatagaagttataaatccagcaaccgaagaagtaatcgggaaagttgctaaaggtaat
aaagctgatgttgataaagccgtcgaggcggcagacgatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagcgttattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgaattaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaaccattttgttgcagcgagagacgcattagataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagcaatcggtgtatct
ggattaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcagcagca
tttgcggctggtagtccagttgtacttaaaccatctgaagaaacaccatttgcagctgtt
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctggtgttgggaatcctttatctgaacatcctaaagtacgcatgatgtca
ttcacaggatcaggccctactggttctaaaattatggaaaaagccgctaaagattttaaa
aaggtatcattagagcttggtggcaaatcaccatatatcgtcctagatgacgtagatatt
aaagaagcggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctaacaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcggtaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagaa
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtagataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcagttatcacttataacgatttagatgaagcgattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gatttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggatattttaaataa

DBGET integrated database retrieval system