KEGG   Staphylococcus aureus M1 (MRSA): BN843_3860Help
Entry
BN843_3860        CDS       T02618                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
saum  Staphylococcus aureus M1 (MRSA)
Brite
KEGG Orthology (KO) [BR:saum00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BN843_3860
Enzymes [BR:saum01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BN843_3860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like Thi4 FAD_binding_2 FAD_binding_3 FAD_oxidored K_oxygenase NAD_binding_9 Glutaredoxin NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CCW20730
LinkDB All DBs
Position
complement(424481..426004)
Genome map
AA seq 507 aa AA seqDB search
MLNADLKQQLKQLLELMEGNVEFVASLGSDDKSKELKDLLTEITDMSPRLSLSEKSLKRT
PSFSVNRPGEETGVTFAGIPLGHEFNSLVLAILQVSGRAPKEKQSIIDQIKKLEGSFHFE
TFISLTCQKCPDVVQALNLMSVINPNITHSMIDGAVFREESENIMAVPAVFLNGEEFGNG
RMTIQDILSKLGSTADASEFENKEPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
QVNDTAGIENFITVKETTGSEFSSNLAAHIDQYDIDAMTGIRATDIEKTDEAIKVTLENG
AVLESKTVIIATGAGWRKLNIPGEEQLINKGVAFCPHCDGPLFENKDVAVIGGGNSGVEA
AIDLAGIVNHVILFEFASELKADNVLQDRLRSLSNVDIKTNAKTTEVVGEDHVTGIRYED
MNTGEEHLLNLDGIFVQIGLLPNTSWLNDAVELNERGEIVIDRNNNTNVPGIFAAGDVTD
QKNKQIIISMGAGANAALNAFDYIIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgctgatttaaaacaacaacttaaacaactattagaactaatggagggcaac
gttgaattcgttgccagccttggttcagatgataaatccaaagaacttaaagatttgttg
acagaaattactgatatgtcacctagactatctctttctgaaaaatctttaaaacgtaca
ccaagtttctcagtcaatcgtcctggcgaagaaacaggtgtaacatttgcaggtattcca
ttaggtcacgagtttaactcacttgttttagcaattttacaggttagtggtcgtgcacct
aaagaaaaacagtcaatcattgaccaaattaaaaaattagaaggttcattccattttgaa
acattcattagtttaacgtgtcaaaaatgtcctgatgtcgttcaagcacttaacttaatg
agtgtgatcaaccctaacatcacgcattctatgattgatggtgcagtgttccgtgaagaa
tctgaaaacatcatggcagtccctgctgtctttttaaatggcgaagaatttggcaatggt
cgtatgacaatccaagatattctttcgaaactaggcagtacggcagatgcatctgagttt
gaaaataaagaaccttatgatgtcttaatcgttggtggtggtcctgctagtggtagtgca
gcgatttacacagcacgtaaaggtttacgtactggtatagttgctgatcgtatcggtggc
caagttaatgatactgctggtattgagaacttcattactgttaaagaaacaactggttct
gaattttcttctaacttagcagcgcacattgatcaatatgacattgatgcaatgacaggt
atacgtgctacagatatcgaaaagactgacgaagcaattaaagttacgttagaaaacggt
gctgtcttagaaagtaaaacagtcattattgctactggtgcaggttggcgtaagctaaac
attccaggtgaagagcaattgattaataaaggtgttgcattctgccctcactgtgacgga
cctctatttgaaaataaagacgtagcagttatcggtggcggtaactctggggttgaagca
gcaattgaccttgctggtatcgttaatcatgttatattattcgaattcgctagcgaatta
aaagcagacaacgtgttacaagatcgtttacgttctttatcaaatgttgatatcaaaaca
aatgccaaaactactgaagttgtcggagaagaccatgttacaggtatacgttacgaagac
atgaacaccggcgaagaacatctacttaacttagatggtatctttgttcaaattggttta
cttccaaacacatcatggttaaacgatgctgttgaattaaacgaacgtggtgaaattgtg
attgatcgtaacaataatacgaatgttcctggaatatttgctgctggcgatgtcacagat
cagaagaacaaacaaattatcatttcaatgggcgctggtgcaaatgcagcattaaatgcc
tttgactatattatcagaaactaa

DBGET integrated database retrieval system