KEGG   Staphylococcus aureus M1 (MRSA): BN843_8340Help
Entry
BN843_8340        CDS       T02618                                 

Definition
(GenBank) Hypothetical NagD-like phosphatase
Organism
saum  Staphylococcus aureus M1 (MRSA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Acid_phosphat_B OST3_OST6
Motif
Other DBs
NCBI-ProteinID: CCW21167
LinkDB All DBs
Position
894437..895216
Genome map
AA seq 259 aa AA seqDB search
MKQYKAYLIDLDGTMYMGTDEIDGAKQFIDYLNVKGIPHLYVTNNSTKTPEQVTEKLREM
HIDAKSEEVVTSALATADYISEQSPGASVYMLGGSGLNTALTEAGLVIKNDEHVDYVVIG
LDEQVTYEKLAIATLGVRNGATFISTNPDVSIPKERGLLPGNGAITSVVSVSTGVSPQFI
GKPEPIIMVKALEILGLDKSEVAMVGDLYDTDIMSGINVGMDTIHVQTGVSTLEDVQNKN
VPPTYSFKDLNEAIAELEK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagtataaagcgtatttaatcgatttagatggcacaatgtatatgggaacagat
gagattgatggagcaaaacaattcatcgattatttaaatgtaaaaggcattcctcattta
tacgtaactaataattcaacaaaaacacctgagcaagtaactgaaaaattacgtgaaatg
cacattgatgctaaatcagaagaggttgtaacgtcagcgttagccactgctgattatatt
tcagaacaatcaccaggagcatcagtatatatgttaggtgggagtggtttaaatactgcg
ttaaccgaagcgggacttgtcattaaaaatgacgagcatgttgattatgtagttattgga
cttgacgaacaagttacatatgaaaagcttgcgattgcaacgttaggtgtaagaaatggt
gcaacatttatttctacaaatcctgatgtatcaattcctaaagagcgtggtttattacct
ggtaatggtgctattacaagtgttgtaagtgtatcgacaggtgtatcgccacaatttatt
ggtaaaccagaaccgattattatggttaaagcattagaaattttaggattagataaatcc
gaagttgctatggtaggcgatttgtacgataccgatattatgtctggtattaacgtaggt
atggatacgattcatgtacaaacaggtgtatctacgttagaagatgtgcaaaataaaaat
gtgccaccaacgtattcttttaaagatttaaatgaagcaatagctgaattagaaaaatag

DBGET integrated database retrieval system