KEGG   Staphylococcus aureus subsp. aureus CN1 (CA-MRSA): SAKOR_02089Help
Entry
SAKOR_02089       CDS       T02826                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
saun  Staphylococcus aureus subsp. aureus CN1 (CA-MRSA)
Pathway
saun00010  Glycolysis / Gluconeogenesis
saun00053  Ascorbate and aldarate metabolism
saun00071  Fatty acid degradation
saun00280  Valine, leucine and isoleucine degradation
saun00310  Lysine degradation
saun00330  Arginine and proline metabolism
saun00340  Histidine metabolism
saun00380  Tryptophan metabolism
saun00410  beta-Alanine metabolism
saun00561  Glycerolipid metabolism
saun00620  Pyruvate metabolism
saun00625  Chloroalkane and chloroalkene degradation
saun01100  Metabolic pathways
saun01110  Biosynthesis of secondary metabolites
saun01120  Microbial metabolism in diverse environments
saun01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAKOR_02089
   00053 Ascorbate and aldarate metabolism
    SAKOR_02089
   00620 Pyruvate metabolism
    SAKOR_02089
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAKOR_02089
   00561 Glycerolipid metabolism
    SAKOR_02089
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAKOR_02089
   00310 Lysine degradation
    SAKOR_02089
   00330 Arginine and proline metabolism
    SAKOR_02089
   00340 Histidine metabolism
    SAKOR_02089
   00380 Tryptophan metabolism
    SAKOR_02089
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAKOR_02089
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAKOR_02089
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAKOR_02089
Enzymes [BR:saun01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAKOR_02089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGU62229
UniProt: T1YCP4
LinkDB All DBs
Structure
PDB: 

Position
complement(2125026..2126471)
Genome map
AA seq 481 aa AA seqDB search
MRSERIMRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADDV
YLEFRHTSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAA
RDALDNYEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEE
TPFAAVILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEK
AAKDFKKVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDA
FLAELKEQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEG
LEKGYFARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGK
DKETLHKVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYF
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
ttgaggagtgaaagaataatgagagactacacaaagcaatacattaatggcgaatgggta
gaaagtaatagtaatgaaacgatagaagttataaatccagcaaccgaagaagtaatcggg
aaagttgctaaaggtaataaagctgatgttgataaagccgtcgaggcggcagacgatgtt
tatttagagttccgtcatacatctgtgaaagaaagacaagcgttattagataaaattgta
aaagaatatgaaaacagaaaagacgatattgtacaagctattacggatgaattaggtgct
cctttatcattatctgagcgtgtccattatcaaatgggactaaaccattttgttgcagcg
agagacgcattagataactacgaatttgaagaacgccgcggagatgatttagttgttaaa
gaagcaatcggtgtatctggattaattacaccgtggaacttccctacaaaccaaacatca
ttaaaattagcagcagcatttgcggctggtagtccagttgtacttaaaccatctgaagaa
acaccatttgcagctgttattttagctgagatttttgataaagtcggtgttcctaaaggt
gtatttaaccttgttaatggtgatggtgctggtgttgggaatcctttatctgaacatcct
aaagtacgcatgatgtcatttacaggatcaggccctactggttctaaaattatggaaaaa
gccgctaaagattttaaaaaggtatcattagagcttggtggcaaatcaccatatatcgtc
ctagatgacgtagatattaaagaagcggctaaagcaacaacaggcaaagttgttaataat
actggtcaagtatgtacagctggtacacgtgttttagtgccaaacaaaattaaagatgca
ttcttagctgaattaaaagaacaatttagccaagtgcgtgtcggtaatccaagagaagat
ggtacacaagtaggccctatcattagtaaaaaacaatttgatcaagtacaaaattatatt
aataaaggtattgaagaaggtgctgaattattttatggtggtcctggtaaaccagaagga
cttgaaaaaggatactttgcacgtccgacaatttttattaatgtagataatcaaatgacg
atagcacaagaagaaatttttgggccagtaatgtcagttatcacttataacgatttagat
gaagcgattcaaattgcaaatgatacaaaatatggtttggcaggatatgttattggtaag
gacaaagaaacattgcataaagtagctcgttctattgaagcaggtacagtagaaataaac
gaagcaggtagaaagccagatttaccatttggtggctataaacaatctggtttaggtcgt
gaatggggcgattatggtattgaagagttcttagaagtgaaatctatagctggatatttt
aaataa

DBGET integrated database retrieval system