KEGG   Staphylococcus aureus subsp. aureus CN1 (CA-MRSA): SAKOR_02395Help
Entry
SAKOR_02395       CDS       T02826                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
saun  Staphylococcus aureus subsp. aureus CN1 (CA-MRSA)
Pathway
saun00010  Glycolysis / Gluconeogenesis
saun00260  Glycine, serine and threonine metabolism
saun00680  Methane metabolism
saun01100  Metabolic pathways
saun01110  Biosynthesis of secondary metabolites
saun01120  Microbial metabolism in diverse environments
saun01130  Biosynthesis of antibiotics
saun01200  Carbon metabolism
saun01230  Biosynthesis of amino acids
Module
saun_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
saun_M00002  Glycolysis, core module involving three-carbon compounds
saun_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:saun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAKOR_02395
  09102 Energy metabolism
   00680 Methane metabolism
    SAKOR_02395
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAKOR_02395
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:saun04131]
    SAKOR_02395
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saun04147]
    SAKOR_02395
Enzymes [BR:saun01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAKOR_02395
Membrane trafficking [BR:saun04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAKOR_02395
Exosome [BR:saun04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAKOR_02395
  Exosomal proteins of melanoma cells
   SAKOR_02395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AGU62535
UniProt: T1YC90
LinkDB All DBs
Position
complement(2417670..2418356)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgccatcgatgtagcttttacatcgttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgaacgccactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaagaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccacctgctgaaaccgaagaacaacgtgaagcttacttagctgatcgtcgatataatcat
ttagataaacgtatgatgccttattctgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattgattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccgcttgtttatgaattaacggatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system