KEGG   Streptomyces autolyticus: BV401_14185Help
Entry
BV401_14185       CDS       T04980                                 

Definition
(GenBank) glycosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00500  Starch and sucrose metabolism
sauo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sauo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BV401_14185
Enzymes [BR:sauo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BV401_14185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: AQA11464
UniProt: A0A1P8XTE7
LinkDB All DBs
Position
complement(3590717..3592108)
Genome map
AA seq 463 aa AA seqDB search
MASSRIPLATAFALAASAAVFVALPQQTARATPPGTKDVTAELFEWKYDSVAKECTSTLG
PAGYGFVEVSPATEHIQGGQWWTSYQPVSYKIAGRLGDRTAFKNMIDTCHAAGVKVVADA
VINHMSAGSGTGTGGSSYTKYTYPGIYQPQDMDDCTSQVSNYQDRWNVQHCELVGLADLD
TGESYVRTRLAQYLDDLLSLGVDGFRVDGAKHIPADDLAAIKSQLSDPGVYWKQEVIHGE
GEAVSPTEYLRNGDVQEFRYGRDLKRVFQSEKLAYLKNFGEGWGYMASGQSGVFVDNWDT
ERNGSTLTYKNGADYTLANVFMLAWPYGSPDVHSGYEFSDNDAGPPNGGAVGACYQDGWK
CQHKWPEISAMVALRNTARGASVTNWWDNGGNAIGFGRGDKAYVAINHESGSLTRTFQTS
LPAGGYCDVQSGKSVTVDSSGQFTATLGTNTALALHTAARTCG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggccagcagccgcatcccccttgccaccgcgttcgccctcgcggcgagcgcggcggtg
ttcgtcgccctgccccagcagaccgcgcgggcgacaccgcccggcaccaaggacgtcacc
gcggaactgttcgagtggaagtacgactccgtcgccaaggagtgcaccagcaccctcggc
cccgccggatacggcttcgtcgaggtgtccccggccaccgagcacatccagggcggccag
tggtggacttcctaccagcccgtcagctacaagatcgccgggcggctcggcgaccgcacc
gcgttcaagaacatgatcgacacttgtcatgccgcgggcgtcaaggtggtcgccgacgcc
gtcatcaaccacatgtccgccggttccggcaccggcaccggcggctcctcgtacaccaag
tacacctaccccgggatctaccagccccaggacatggacgactgcacctcacaggtcagc
aattaccaggaccgctggaacgttcagcactgcgagctggtgggcctcgccgacctggac
accggtgagtcatacgtcaggacccggctcgcccagtacctcgacgacctgctctcgctc
ggcgtggacggcttccgcgtcgacggcgccaagcacatcccggcggacgacctggccgcc
atcaagagccagttgagcgaccccggcgtctactggaagcaggaggtcatccacggcgag
ggcgaggcggtctccccgacggagtatctgcgcaacggcgatgtgcaggagttccgctac
ggccgtgacctcaagcgggtgttccagagcgagaagctggcgtatctgaagaacttcggc
gagggctggggctatatggcgagcggccagtccggtgtcttcgtcgacaactgggacacc
gagcgcaacggctccaccctcacctacaagaacggcgccgactacaccctggccaacgtc
ttcatgctggcctggccctacggctcacccgacgtccactccggctacgagttcagcgac
aacgacgcgggcccgccgaacggcggcgcggtgggcgcctgctaccaggacggctggaag
tgccagcacaagtggcccgagatcagcgccatggtcgccctccgcaacacggcccggggc
gcttcggtgaccaactggtgggacaacggcggcaacgccatcggcttcgggcgcggcgac
aaggcgtacgtggccatcaaccacgagagcggctccctcacccggaccttccagacctcg
ctcccggcgggcggctactgcgacgtacagagcggcaagtccgtcacggtcgactcctcg
ggccagttcacggccacgctgggcacgaatacggcgctggccctgcacacggccgcccgc
acctgcggctag

DBGET integrated database retrieval system