KEGG   Streptomyces autolyticus: BV401_21455Help
Entry
BV401_21455       CDS       T04980                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00010  Glycolysis / Gluconeogenesis
sauo00053  Ascorbate and aldarate metabolism
sauo00071  Fatty acid degradation
sauo00280  Valine, leucine and isoleucine degradation
sauo00310  Lysine degradation
sauo00330  Arginine and proline metabolism
sauo00340  Histidine metabolism
sauo00380  Tryptophan metabolism
sauo00410  beta-Alanine metabolism
sauo00561  Glycerolipid metabolism
sauo00620  Pyruvate metabolism
sauo00625  Chloroalkane and chloroalkene degradation
sauo00903  Limonene and pinene degradation
sauo01100  Metabolic pathways
sauo01110  Biosynthesis of secondary metabolites
sauo01120  Microbial metabolism in diverse environments
sauo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BV401_21455
   00053 Ascorbate and aldarate metabolism
    BV401_21455
   00620 Pyruvate metabolism
    BV401_21455
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BV401_21455
   00561 Glycerolipid metabolism
    BV401_21455
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BV401_21455
   00310 Lysine degradation
    BV401_21455
   00330 Arginine and proline metabolism
    BV401_21455
   00340 Histidine metabolism
    BV401_21455
   00380 Tryptophan metabolism
    BV401_21455
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BV401_21455
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BV401_21455
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BV401_21455
Enzymes [BR:sauo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BV401_21455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AQA12629
UniProt: A0A1P8XWP4
LinkDB All DBs
Position
complement(5391506..5392963)
Genome map
AA seq 485 aa AA seqDB search
MSYFSELALQFIDGEWRGGSGSWDIVDFNPYNGEKLASITVATVEEVDLAYRAAERAQPE
WGATNPYARRAVFERVLRIIEDREKELTETIIAECGGTHVKAGFELHLAKEFLREAIHLA
LRPEGRILPSPVDGKENRLYRLPVGVVGVISPFNFPFLLSLKSVAPALALGNAVVLKPHQ
NTPVCGGGLVAKIFEEAGLPAGLLNVVITDIAEIGDALIEHPIPKVLSFTGSDKVGRHVA
TVAASHFKRTVLELGGNSALVVLDDADLDYAVDAAVFSRFVHQGQVCMAANRVLVDRAIE
REFTERFVAKVETLKVGDPGDPTTHIGPLINEGQAEAIAQLVDQTIAEGATALVRGRTEG
SLMGPTVLSGVPEGSAILGQEVFGPVVTLIPFDGDDEAVRIANDTDYGLSGAVHTSDIER
GVRFAQRVHTGMIHVNDSTVHDEPIVPFGGEKHSGLGRLNGESMIEDFTTTKWISIQHGR
SQFPF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacttctccgagttggcccttcagttcatcgacggcgagtggcgcggcggaagc
ggttcctgggacatcgtcgacttcaacccctacaacggggagaagctggcctccatcacc
gtggcgaccgtcgaggaggtggacctcgcctaccgggcggccgagcgggcgcagccggag
tggggcgccaccaacccctatgcccggcgggcggtcttcgagcgggtgctgcggatcatc
gaggaccgtgagaaggagctcaccgagacgatcatcgcggagtgcggcggcacccatgtg
aaggcgggtttcgagctgcacctcgccaaggagttcctgcgcgaggcgatccacctcgcg
ctgcggcccgagggccgcatcctgccgtcgccggtcgacggcaaggagaaccgcctctac
cggctgccggtgggcgtggtcggtgtgatcagcccgttcaacttcccgttcctgctgtcg
ctgaagtcggtcgcccccgcgctggccctcggcaacgccgtcgtcctcaagccccaccag
aacaccccggtctgcggcggcggcctggtcgccaagatcttcgaggaggccgggctgccc
gccgggctgctcaatgtcgtgatcaccgacatcgcggagatcggcgacgccctgatcgag
caccccataccgaaggtgctctccttcaccggctccgacaaggtcggccggcacgtcgcc
accgtggccgcctcccacttcaagcgcacggtcctggagctgggcggcaacagcgcgctg
gtcgtgctcgacgacgccgatctggactacgcggtggacgcggccgtcttcagccgcttc
gtccaccaggggcaggtctgcatggcggccaaccgggtgctggtggaccgggcgatcgag
cgggagttcaccgagaggttcgtggccaaggtggagacgctgaaggtgggcgacccgggc
gaccccaccacccatatcggcccgctgatcaacgagggccaggccgaggcgatcgcccag
ctcgtcgaccagacgatcgccgagggcgccaccgcgctggtccgggggcgcaccgagggc
agcctgatggggccgaccgtgctcagcggggtcccggaggggtcggcgatcctcggccag
gaggtcttcggcccagtggtgacgctgatcccgttcgacggcgacgacgaggcggtgcgg
atcgccaatgacacggactacgggctcagcggcgccgtgcacaccagcgacatcgagcgc
ggggtgcggttcgcccagcgggtccacaccggcatgatccatgtgaacgacagcacggtc
cacgacgagccgatcgtgccgttcggcggcgagaagcactccggtctcggccggctcaac
ggggagtcgatgatcgaggacttcaccaccaccaagtggatctccatccagcacggccgg
agccagttcccgttctga

DBGET integrated database retrieval system