KEGG   Streptomyces autolyticus: BV401_24285Help
Entry
BV401_24285       CDS       T04980                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00380  Tryptophan metabolism
sauo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sauo00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    BV401_24285
Enzymes [BR:sauo01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BV401_24285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP Glyco_hydro_17
Motif
Other DBs
NCBI-ProteinID: AQA16446
UniProt: A0A1P8Y7M8
LinkDB All DBs
Position
6004004..6005209
Genome map
AA seq 401 aa AA seqDB search
MPPAALTDEAARLDAADRLRAKRDAFTLDDVIYLDGNSLGALPRAVPPRLAEVVAREWGQ
LRIRSWEESGWWTAPERIGDRVGRLVGAAPGQVVVGDSTSVNVFKAVVAAVRMAQERGAH
RDQILVDEATFPTDGYIAESAARMTGCTLRPVAAGDVPSAVGSRTAVAFVNHVDYRTGRL
HDLPGTTAAVHAAGALVVWDLCHSAGALPVGLDAHGVDLAVGCTYKYLNGGPGAPAYLYV
ARAHQPGFDSPLPGWNSHADPFGMASAYTPADGAVRGRVGTPDILSMLALEAALEVWDDV
TIEDVRAKSLALTDFFLRCVEDYAPAGRVRSLTPAAHTERGSQVALRCADAGEVMAELVR
RGVVGDFRRPDVLRFGFTPLYTGFAEVERAARVLAAVLKES
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ctgcccccggccgccctcaccgacgaggccgccaggctcgacgcggccgaccggctgcgc
gccaagcgcgacgccttcaccctcgacgacgtcatctacctcgacggcaactcactgggt
gccctgccgcgcgccgtcccgccccggctggccgaggtggtcgcccgcgaatgggggcag
ctgcgcatccgctcctgggaggagagcggctggtggaccgcgcccgagcggattggtgac
cgcgtcggccggctcgtcggcgccgcccccggccaggtggtcgtcggcgactcgacgagc
gtgaacgtcttcaaggcggtcgtcgcggccgtacggatggctcaggagcgcggcgcccac
cgcgatcagatcctggtcgacgaggccaccttccccaccgacgggtatatcgccgagtcc
gccgcccggatgaccggctgcaccctgcggccggtggccgcgggcgacgtcccctccgct
gtcggctcccggaccgccgtcgcgttcgtcaaccacgtggactaccgcaccggccgcctc
cacgacctgcccgggaccacggccgccgtgcacgcggcgggcgcgctcgtggtgtgggac
ctgtgccacagcgcgggcgccctgccggtcgggctggacgcccacggcgtggacctcgcg
gtcggctgcacgtacaagtacctcaacggcgggcccggcgcgcccgcgtatctgtacgtc
gcgcgtgcgcatcagcccggcttcgactccccgctgcccggctggaactcgcatgccgac
cctttcggcatggcctccgcctacaccccggccgacggtgcggtccgcggccgcgtcggc
accccggacatcctctcgatgctggcgctggaggccgcgctcgaggtgtgggacgacgtg
acgatcgaggacgtcagggccaagagcctggccctgacggacttcttcctccgctgcgtc
gaggactacgccccggcgggccgcgtccggtccctcacccccgccgcacacaccgagcgc
ggcagccaggtggcgctgcggtgcgcggacgcgggggaggtgatggcggagctggtgcgg
cgcggtgtcgtgggcgacttccgccgccccgatgtgctgcgcttcggcttcaccccgctg
tacaccggcttcgccgaggtggagcgggcggcgcgggtgctggccgccgtgctgaaggag
agctga

DBGET integrated database retrieval system