KEGG   Streptomyces autolyticus: BV401_26335Help
Entry
BV401_26335       CDS       T04980                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00473  D-Alanine metabolism
sauo01100  Metabolic pathways
sauo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BV401_26335
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BV401_26335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sauo01011]
    BV401_26335
Enzymes [BR:sauo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BV401_26335
Peptidoglycan biosynthesis and degradation proteins [BR:sauo01011]
 Precursor biosynthesis
  Racemase
   BV401_26335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DUF3775
Motif
Other DBs
NCBI-ProteinID: AQA13421
UniProt: A0A1P8XZ01
LinkDB All DBs
Position
6446744..6447898
Genome map
AA seq 384 aa AA seqDB search
MDETPMRARAVVDLAALRANVRALRATAPTAELMTVVKSDAYGHGMIPCARAAREAGAGW
LGTATPEEAFALRAAGDTGRMMCWLWTPGGPWREAIEADIDVSASGLWALREAVAAARAC
GRTARLQLKADTGLGRNGCQPADWPALVDEARAAEAEGAIRVTGLWSHFACADEPGHPSI
AAQLAVFRELVAHAERAGLRPEVRHLANSPATLTVPESHFDLVRTGIATYGISPSPELGT
AADFGLRPAMTLSATLASVKRVPGGHGVSYGHRYVTPGETTLALVPVGYGDGIPRHASGT
GPVLVAGKWRTVAGTVAMDQFVVDLGGDTAAPGDEAVLFGPGDRGEPTAEDWARAVGSIA
YEIVTRISARIPRVYVGEDGGTGN
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggacgagacaccgatgcgcgcccgtgccgtggtcgatctggccgccctacgggccaac
gtgagggcgctgcgcgccacggcacccacggccgagctgatgaccgtggtgaagtcggac
gcctatggccacggcatgatcccgtgtgcgcgcgccgcccgtgaggcgggcgcgggctgg
ctgggcacggccacgcccgaggaggcgttcgcgctgcgggcggcgggggacacgggccgg
atgatgtgctggctgtggacgcccggtggcccgtggcgggaggcgatcgaggcggacatc
gacgtgtcggccagcgggctgtgggcgctgcgcgaggccgtcgccgcggcccgcgcatgc
ggccgtaccgcacggctccagctgaaggcggacaccgggctcggccgcaacggctgccag
cccgccgactggccggcgctggtcgacgaggcgcgcgcggccgaggcggaaggggccatc
cgggtgaccgggctgtggtcccacttcgcctgcgccgacgagccgggccatccgtccatc
gccgcccagctggcggtcttccgcgagctggtggcgcacgccgaacgggcggggctgcgg
cccgaggtgcgccacctggccaactccccggccaccctgaccgtgcccgagtcccacttc
gacctggtccggaccggtatcgccacctacggcatctccccgagccccgaactcggcacg
gccgccgacttcgggctgcggccggccatgacgctctccgccacgctcgcctccgtcaag
cgggtgccgggcggacacggcgtctcctacggacaccgctatgtgacccccggcgagacg
accctcgcactggtgcccgtcggttacggggacggcattccgcgccatgcctcgggcacc
gggccggtgctggtcgcgggcaagtggcggaccgtcgctggcacggtcgccatggaccag
ttcgtggtggacctgggcggcgacacggccgccccgggggacgaggcggtgctgttcggc
ccgggggaccggggcgagccgaccgccgaggactgggcgcgggccgtgggctcgatcgcc
tatgagatcgtgaccaggatctcggcccggatcccccgcgtttatgtaggtgaggacggg
ggcacagggaactga

DBGET integrated database retrieval system