KEGG   Streptomyces autolyticus: BV401_26880Help
Entry
BV401_26880       CDS       T04980                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BV401_26880
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sauo03400]
    BV401_26880
Enzymes [BR:sauo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BV401_26880
DNA repair and recombination proteins [BR:sauo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BV401_26880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AQA13516
UniProt: A0A1P8XZA0
LinkDB All DBs
Position
6586341..6587339
Genome map
AA seq 332 aa AA seqDB search
MSPITEVEGRRITLRNLDKVIHPATGTTKGELLHYLASTADVLLGHLHGRPLAFLRYPDG
PDGQKFFTKNPPPGTPSWVTTAEVTRHKGETARQVLIQDLPSLMWAANLVVELHTPMWRI
DQGVGSADRLVLDLDPGPPATIVDCRVVAVWLRERLRADGLTAYAKTSGSKGLHLLVPLE
PTPSRQATAYARRLALEAANAMPDLVIRKMTRSLRPGKVYVDFSQNAAAKTTAAPYTPRA
LPEPAVSAPVTWEEVEECGDPSALTFLIDDIPARLDRHGDLLAPLLDPAQARPLPTGGGG
GDDGGDADEDEAVDEGEADDEDAADDESAAER
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtccccgatcacggaggtggaggggcggcggatcacgctcaggaacctcgacaaggtc
atccatccggccaccggcacgacgaagggcgagctgctgcactatctggcgtccaccgcg
gacgtcctcctcggccatctgcatgggcggccactggcgttcctgcgctacccggacggc
cccgacggccagaagttcttcaccaagaacccgcctccgggcacgccctcctgggtgacc
acggccgaagtcacccgccataagggggagaccgcgcggcaggtgctgatccaggacctg
ccctcgctgatgtgggcggccaacctcgtggtggagctccacactccgatgtggcggatc
gaccagggcgtgggcagcgccgaccggctcgtcctcgacctcgaccccgggccgcccgcc
acgatcgtggactgtcgcgtcgtcgccgtatggctgcgggagcggctgcgcgccgacggc
cttacggcttacgccaagaccagcggctccaaggggctccatctgctggtgccgctggag
ccgactccgtcccgccaggccaccgcctacgccagacggctggccctggaggccgcgaac
gccatgccggacctggtcatccgtaagatgacccgctcgctgcggccggggaaggtgtac
gtggacttcagccagaacgcggccgcgaagaccaccgccgccccgtacaccccgcgagcc
ctccccgaaccggccgtctccgcgcccgtcacctgggaggaggtcgaggagtgcggcgac
ccctcggcgctgaccttcctgatcgacgacatccccgcgcggctcgaccgccacggggat
ctgctggccccgctgctggacccggcgcaggcacgcccgctgccgacgggcggcgggggc
ggggacgacggcggagacgccgacgaagacgaggccgtcgatgagggcgaggcggacgac
gaagacgcggcggacgacgaaagcgcggcggagcgatga

DBGET integrated database retrieval system