KEGG   Streptomyces autolyticus: BV401_26885Help
Entry
BV401_26885       CDS       T04980                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
sauo  Streptomyces autolyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AQA13517
UniProt: A0A1P8XZA2
LinkDB All DBs
Position
6587393..6588295
Genome map
AA seq 300 aa AA seqDB search
MEVALARVVPTLPTAPPGRRLAYEPKFDGHRLLIFRLVDTVRMQARSGRIVTRAFPDLEA
AARPLPPGTVLDGEVVVWAGGRTDFAAVQKRAFAASESRAGRLARELPASYAAFDLLAIG
AEDLRPLPYEQRRARLMALLEPLGPPLQAVPMTTDPELAATWYEALPEIGVEGLVIKDLD
QPYRPGRHWRKLRHSEARDAVVVGVVGPRLRPRALALVLPGDDAPVISAPLSTGVRAQLG
SALRDLPDPQSPPTELPTALDRVGAEIAYRPIAPDLTVEVRHESTVRHAATTVMRLRIPD
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtggaggtggcgctggcccgtgtcgtccccaccctgccgaccgccccgcccggacggcgg
ctggcgtacgagcccaagttcgacgggcatcggctgctgatcttccggttggtggacacc
gtaaggatgcaggcacgctccggtcgcatcgtcacccgcgccttccccgacctggaggcc
gccgcgcggccgcttccgcccggtacggtcctcgacggtgaggtggtggtgtgggcgggc
ggccgtacggacttcgccgccgtccagaagcgcgccttcgccgcgtccgagtcccgggcg
ggccggctcgcccgggaactgcccgcctcctacgccgccttcgacctgctcgcgatcggg
gcggaggatctgcggccgcttccttacgaacagcgtcgcgcccggctgatggcgctgctc
gaaccgctcggcccaccgctccaggccgtgcccatgaccaccgacccggagctcgccgcc
acctggtacgaggcgctgccggagatcggcgtcgagggcctggtcatcaaggatctggat
cagccgtaccggccgggccgccactggcggaagctgcgccattcggaggcccgtgacgcc
gtcgtcgtcggtgtggtcgggccccggctccgcccccgcgccctggcgctggtgctcccc
ggcgatgacgcgcccgtgatctccgccccgctttcgacgggcgtccgcgcccagctcggc
tcggccctgcgcgacctgcccgacccacagtccccgcccaccgaactccccaccgcgctg
gaccgggtcggcgccgagatcgcctaccgccccatcgccccggatctgacggtggaggtc
cgccacgagagcacggtccgccacgcggccacaacggtcatgcgcctccgcatccccgac
tga

DBGET integrated database retrieval system