KEGG   Streptomyces autolyticus: BV401_29960Help
Entry
BV401_29960       CDS       T04980                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
sauo  Streptomyces autolyticus
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BV401_29960
Enzymes [BR:sauo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BV401_29960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N
Motif
Other DBs
NCBI-ProteinID: AQA14007
UniProt: A0A1P8Y0N4
LinkDB All DBs
Position
complement(7250391..7250786)
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVQVSAHCDLPCGVYDPAQARIEAESVKAIQEKYQANEDPHFRARATTIKEE
RAELAKHHISVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSTDPATGQKALDYIAQ
VDKIFWETKKG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctctcccgcctgttcgcccccaaggttcaggtcagcgcccactgcgatctgccctgc
ggcgtgtacgacccggcccaggcccgtatcgaagccgagtccgtcaaggccatccaggag
aagtaccaggccaacgaggacccgcacttccgcgcccgggccaccaccatcaaggaggag
cgcgcggagctcgccaagcaccacatctcggtgctgtggagcgactacttcaagcccccg
cacttcgagaagtaccccgagctgcaccagctggtcaacgacaccctcaaggccctgagc
gcggccaagggctcgaccgacccggccacggggcagaaggctctggactacatcgcccag
gtcgacaagatcttctgggagaccaagaagggctga

DBGET integrated database retrieval system