KEGG   Streptomyces autolyticus: BV401_31500Help
Entry
BV401_31500       CDS       T04980                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00473  D-Alanine metabolism
sauo00550  Peptidoglycan biosynthesis
sauo01100  Metabolic pathways
sauo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BV401_31500
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BV401_31500
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BV401_31500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sauo01011]
    BV401_31500
Enzymes [BR:sauo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BV401_31500
Peptidoglycan biosynthesis and degradation proteins [BR:sauo01011]
 Precursor biosynthesis
  Amino acid ligase
   BV401_31500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATP-grasp_3 TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AQA14260
UniProt: A0A1P8Y1Z5
LinkDB All DBs
Position
7606988..7608160
Genome map
AA seq 390 aa AA seqDB search
MSSQTPSPGPVPASSGGERRKPRVAVVFGGRSSEHAISVVTAGAVLRAIDREKYDVLPIG
ITADGRWALTADEPERMAIANRELPSVERLAESSEGSVVLPVDPGNREVVYSEPGAVPKA
LGDVDVVFPMLHGPYGEDGTLQGLLELSGVPYVGAGVLASAVGMDKEYMKRVFVSFGLPV
GPYEVIRPRAWEQEPSAARRRVVEFAEEHGWPLFVKPARAGSSIGISKVDDPADLDEAIE
EARRHDPKVIVEALLRGREIECGVLEYEDGPRASVPAEIPPVSSHAFYDFEAKYIDSADG
IVPAPLTEEQTRRVQELAVAAFEAASCEGLVRADFFLLDSGEFVINEINTMPGFTPISMY
PRMWQESGVSYPELVDRLLQAALRRSTGLR
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccagaccccttccccaggccctgtcccggcttcctccggaggcgagcggcgg
aagccgcgcgtcgccgtcgtcttcggcggccgcagctccgagcacgccatctcggtggtc
accgcgggcgccgtgctgcgcgccatcgaccgtgagaagtacgacgtgctgccgatcggc
atcaccgcggacggccgttgggcgctgaccgcggacgagccggagcggatggccatcgcc
aaccgcgagctgccgagcgtcgaacggctcgccgagtccagcgagggctcggtcgtcctc
ccggtcgacccggggaaccgcgaggtcgtctacagcgagccgggggcggtgcccaaggca
ctgggcgacgtcgacgtcgtcttccccatgctgcacggtccgtacggcgaggacggcacc
ctccaggggctgctggagctgtccggggtgccgtatgtgggcgccggggtgctcgcctcc
gcggtgggcatggacaaggagtacatgaagcgggtgttcgtctccttcgggctgcccgtc
ggcccgtacgaggtgatccgcccccgcgcctgggagcaggaaccttccgccgcccgccgc
agggtcgtggagttcgccgaggagcacggctggccgctcttcgtgaagcccgcgcgcgcc
ggctcctccatcgggatcagcaaggtcgacgaccccgcggacctggacgaggccatcgag
gaggccaggcgccacgacccgaaggtcatcgtggaggcgctgctgcgcggccgcgagatc
gaatgcggagtgctggagtacgaggacgggccgcgggccagcgtgcccgccgagatcccg
ccggtctcctcgcacgccttctacgacttcgaggcgaagtacatcgactcggcggacggc
atcgtgcccgcgccgctcaccgaggagcagacccggcgggtccaggagctcgcggtggcc
gccttcgaggcggcgtcctgcgaggggctggtccgggccgacttcttcctgctggacagc
ggcgagttcgtgatcaacgagatcaacaccatgcccggcttcaccccgatctcgatgtac
ccgcgcatgtggcaggagagcggagtgagctaccccgagctggtggaccggctgctccag
gccgcgctgcgccgctcgacggggctgcgctag

DBGET integrated database retrieval system