KEGG   Streptomyces autolyticus: BV401_34415Help
Entry
BV401_34415       CDS       T04980                                 

Gene name
katE
Definition
(GenBank) catalase HPII
  KO
K03781  catalase [EC:1.11.1.6]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00380  Tryptophan metabolism
sauo00630  Glyoxylate and dicarboxylate metabolism
sauo01110  Biosynthesis of secondary metabolites
sauo01130  Biosynthesis of antibiotics
sauo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BV401_34415 (katE)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BV401_34415 (katE)
Enzymes [BR:sauo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BV401_34415 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase_C Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AQA14752
UniProt: A0A1P8Y2Y8
LinkDB All DBs
Position
complement(8352026..8354125)
Genome map
AA seq 699 aa AA seqDB search
MTEDRKERQREKYRAADPAEGPLTTDQGVAVDHTDDSLTVGERGPTLMEDFHFREKVTHF
DHERIPERVVHARGAGAYGYFEPYESCAEFTRAAFLQDPSVRTPVFVRFSTVQGPRGSAD
TVRDVRGFATKFYTSEGNYDLVGNNMPVFFIQDGIKFPDFVHALKPEPQNEIPTGASAHD
TLWDFVSLQPETMHMMMWLMSDRAIPRSFRMMQGFGVHTFRFVDAQGHGTFVKFHWKPKL
GVHSLVWDEAQECAGRDPDFNRRDLWQAIEAGQYPEYELGVQLVPEEDEFNFDFDLLDAT
KIIPEEQVPVRPIGHMVLDRNPDNFFAETEQVAFHTGNVVPGIDFTNDPLLQARNFSYLD
TQLIRLGGPNFSQIPVNQPVAPARTNHRDGYHQTMIHKGTSYSPNSLGGGCPALAGADGY
AFSHYAERVEGHKIRKRSESFKDFYSQAALFWNSMADWERRHIVEAFQFELGKVDAVHVR
ERTVEQLAHVDYDLASQVAQGIGVARPEPGANNHKPQASPALSLDNLHGDGSIRTRQIAV
LVTDGVDTGQLAQAQEALTNQGAIVEAIAPHDGKVLGADGNGYAVDRALPTVASVLYDAV
LLPGGPTGTPALGSDSAAMRFVRDAYRHGKPIGALGSGVGILSTLEPEGLHIASGHGHVC
TDRGVVTDTTTGTASEDFTRAFTEAIAAHRHWNRPPVRC
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgacggaggaccgcaaggagcggcagcgcgagaagtaccgtgccgccgaccccgccgaa
ggaccgctgaccaccgaccagggcgtggcggtcgaccacaccgatgactccctcaccgtg
ggcgaacgcggccccaccctgatggaggacttccacttccgcgaaaaggtcacccacttc
gaccatgagcgcatcccggagcgggtggtgcacgcgcggggcgcgggcgcgtacggctac
ttcgagccgtacgagtcctgtgcggagttcacccgcgccgccttcctccaggacccgtcc
gtgcgcaccccggtcttcgtacggttctccaccgtgcaggggccccggggctcggcggac
acggtgcgggacgtacggggcttcgccacgaagttctacacctcggagggcaactacgac
ctggtcggcaacaacatgccggtcttcttcatccaggacgggatcaagttccccgacttc
gtgcacgcgctcaaaccggagccgcagaacgagatcccgaccggcgcctccgcccatgac
acgctgtgggacttcgtctcgctccagcccgagaccatgcacatgatgatgtggctgatg
tcggaccgggcgattccgcgcagcttccggatgatgcagggcttcggggtgcacaccttc
cgcttcgtggacgcgcaggggcacggcacctttgtgaagttccactggaagccgaagctg
ggcgtccactcgctggtgtgggacgaggcgcaggagtgcgcgggccgcgaccccgacttc
aaccggcgcgatctgtggcaggcgatcgaggcgggacagtaccccgagtacgagctgggg
gtgcagctggtcccggaggaggacgagttcaacttcgacttcgatctgctcgacgccacg
aagatcattccggaggagcaggtgccggtgcggccgatcggccatatggtcctggaccgc
aacccggacaacttcttcgcggagaccgagcaggtggccttccacaccgggaacgtcgtc
cccggtatcgacttcaccaacgacccgctgctccaggcccggaacttctcatacctggac
acccagctgatccggctgggcgggcccaacttctcacagatcccggtcaaccagccggtc
gccccggcccgcaccaaccaccgggacggctaccaccagaccatgatccacaagggcacc
agctactcccccaactcactcggcggaggctgcccggccctcgccggggcggacggctac
gccttctcccactacgcggagcgggtcgagggccataagatccgcaaacggagcgagtcc
ttcaaggacttctacagccaggccgcgctgttctggaacagcatggccgactgggagcgg
cgccacatcgtggaggctttccaattcgagctgggcaaggtcgacgcggtgcatgtgcgg
gaacgcaccgtcgaacagctggcccatgtcgactacgacctcgcctcacaggtcgcccag
ggcatcggcgtggccaggccggaacccggcgccaacaaccacaaaccccaggcatcaccc
gcgctgagcctggacaacctgcatggcgacggctcgatccgcacccgccagatcgcggtg
ctggtcaccgacggagtcgacaccggccagctcgcccaggcccaggaggcgctcaccaac
cagggcgccatcgtcgaggcgatcgccccgcacgacggcaaggtcctcggcgccgacggc
aacggctacgcggtcgaccgtgccctccccaccgtcgcctccgtcctctacgacgccgtc
ctcctccccggcggccccaccggcacccccgccctgggctccgacagcgccgccatgcgc
ttcgtccgcgacgcctaccgccacggcaaacccatcggcgcactcggctccggcgtcggc
atcctctccaccctcgaacccgagggcctccacatcgcctcgggccacggccacgtctgc
accgaccgcggcgtcgtcaccgacaccacaacgggcaccgccagcgaagacttcacccga
gccttcacagaagccatagccgcccaccgccactggaaccgcccaccggtccgctgctga

DBGET integrated database retrieval system