KEGG   Streptomyces autolyticus: BV401_38210Help
Entry
BV401_38210       CDS       T04980                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
sauo  Streptomyces autolyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AQA15378
UniProt: A0A1P8Y4I2
LinkDB All DBs
Position
9227134..9228207
Genome map
AA seq 357 aa AA seqDB search
MDLPVMPPVQPMLAKAVATIPPGMVYEGKWDGFRAIVFRDGDEIEISSRTTKPLTRYFPE
LAEALLANLPPRCVLDGEIVIVRGGRLDFDALLERIHPADSRVRLLAKTTPAAFVAFDIL
ALGDASLMATPLSERREALTEALRGAADPVHLAPCTDELEVARQWFEQYEGAGLDGVVAK
SPDLRYLPGERVMVKVKHERTADCVVAGYRVHKSGQGIGSLLLGLYDATGRLQHVGVSAA
FSARRRQELMAELEPLRMETVEGHPWADWAREEAHARGRMPGAPSRWTGVKDLSWVPLRP
ERVCEVAYDHMQSGRFRHTARFRRWRPDREPPQCTYDQLEEPVSYDLGQVLGSVREP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaccttccggtgatgcctcccgtccagccgatgctggccaaggccgtggccacgatc
ccgcccggaatggtctacgagggcaaatgggacggcttccgggccatcgtcttccgcgac
ggggacgagatcgagatcagcagccgtaccaccaagccgctcacccgttacttccccgaa
ctggccgaggcgctgctcgccaacctcccgccgcgctgcgtcctggacggcgagatcgtc
atcgtgcgcggcgggcggctcgacttcgacgccctcctggagcggatccaccccgccgac
tcccgggtgcggctgctggcgaagaccaccccggccgccttcgtggccttcgacatcctc
gccctcggcgacgcctcgctgatggccaccccgctcagcgagcgccgcgaggcgctgacc
gaggcgctgcgcggcgccgcggacccggtgcacctcgccccctgcaccgacgagctcgag
gtggcccggcagtggttcgagcagtacgagggggcggggctcgacggcgtcgtggccaag
agccccgacctccgctacctccccggagagcgcgtgatggtcaaggtcaagcacgagcgc
accgccgactgtgtggtggccggctaccgcgtccacaaatcagggcagggcatcggctcc
ctgctgctgggcctgtacgacgccaccggccgcctccagcacgtgggcgtcagcgcggcc
ttctccgcgcgccgccgccaggagctgatggccgagctggaaccgctgcgcatggagacc
gtcgaaggccacccctgggccgactgggcgcgcgaggaggcccatgcccggggccggatg
ccgggcgcgcccagccgctggaccggggtcaaggacctgtcgtgggtgccgctgcgcccc
gagcgggtgtgcgaggtggcctacgaccatatgcagagcggccgcttccggcacaccgcc
cgcttccgccgctggcggccggaccgggagcccccgcagtgcacctacgaccagctggag
gagccggtctcctacgatctgggccaggtgctggggtccgtgcgggagccgtag

DBGET integrated database retrieval system