KEGG   Streptomyces autolyticus: BV401_40215Help
Entry
BV401_40215       CDS       T04980                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00040  Pentose and glucuronate interconversions
sauo00051  Fructose and mannose metabolism
sauo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BV401_40215
   00051 Fructose and mannose metabolism
    BV401_40215
Enzymes [BR:sauo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     BV401_40215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AQA15714
UniProt: A0A1P8Y5L4
LinkDB All DBs
Position
complement(9817737..9818744)
Genome map
AA seq 335 aa AA seqDB search
MNDATAAILHGPKDVRIERRPIPRPAPGEVLVEIGAVGLCGSDLHYYAHGENGPNVLRSP
TALGHEAAGTVLGDGGPLPAGTRVAIEPAIPCGRCHACRAGRYNQCPHGHCFGSPPTDGA
LTGHLTVPAEFAHPLPGDLPLGSGALIEPLAVALHAVRRGNVAAGDRVLVTGAGPIGLLV
LQAARAVGAGETVVTDINPGRLAHAHRLGADRTLDTSREPLPQEPLFDIALDCSGIEAAL
TAAAHAVRPGGTLVAVGNPPRPRTTLPLAWMQRQELSLVTAFRYAGEFPAAVSLAAAGRV
DLESLITARFPLEHSADAFRTALCDPAQLKVVIEP
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgccaccgccgcgatcctgcacggcccgaaggatgtgcgcatcgagcggcgc
ccgattccccgacccgcccccggcgaggtcctcgtggagatcggcgcggtcgggctgtgc
ggctccgatctgcactactacgcccacggcgagaacggccccaatgtgctccgctccccc
accgcactcggccacgaggcggccggaacggtcctgggggacggcggcccgctgcccgcg
ggcacccgggtcgcgatcgagcccgccatcccgtgcggacgctgccacgcctgccgcgcg
ggccgctacaaccaatgcccccacggccactgcttcggctccccgcccaccgacggcgcc
ctgaccggacacctcaccgtgcccgcggagttcgcccatccgctccccggcgacctcccc
ctcggttccggagcgctcatcgaacccctcgcggtcgccctgcacgccgtacgccgcggc
aatgtcgccgccggggaccgggtgctggtcaccggcgcaggcccgatcggcctgctggtc
ctccaggccgcccgcgcggtgggcgcgggcgagaccgtggtgaccgacatcaaccccggc
cggctggcccacgcccaccgcctgggcgccgaccggaccctggacacctcccgcgaaccc
ctcccccaggagccgctgttcgacatcgcactcgactgctcaggcatcgaggccgctctg
accgccgccgcccacgcggtacgccccggcggcaccctggtcgccgtcggcaatccaccc
cggccccggaccaccctgccgctggcctggatgcaacgccaggagctcagcctggtcacc
gccttccgctacgccggggagttccccgcggcggtgtccctggcggccgccgggcgggtc
gacctggaatcactgatcaccgcccgcttccccctggaacattccgcggacgccttccgg
acggcgctctgcgaccccgcacagctcaaggtcgtcatcgagccctga

DBGET integrated database retrieval system