KEGG   Streptomyces autolyticus: BV401_40500Help
Entry
BV401_40500       CDS       T04980                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00250  Alanine, aspartate and glutamate metabolism
sauo00410  beta-Alanine metabolism
sauo00640  Propanoate metabolism
sauo00650  Butanoate metabolism
sauo01100  Metabolic pathways
sauo01120  Microbial metabolism in diverse environments
Module
sauo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BV401_40500
   00650 Butanoate metabolism
    BV401_40500
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BV401_40500
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BV401_40500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sauo01007]
    BV401_40500
Enzymes [BR:sauo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BV401_40500
Amino acid related enzymes [BR:sauo01007]
 Aminotransferase (transaminase)
  Class III
   BV401_40500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AQA15761
UniProt: A0A1P8Y5L3
LinkDB All DBs
Position
9886963..9888222
Genome map
AA seq 419 aa AA seqDB search
MTNLSPQLRQATPVVAVRGEGVHVDGEDGRRYLDFTAGIGVTSTGHCHPRVVAAAQEQVG
TLIHGQYTTVMHPPLRRLVEKLGEVLPAGLDSLFFTNSGSEAVESALRLARQATGRPNVL
VCHGGFHGRTVAAASMTTSGTRFRSGFSPLMSGVVVTPFPTAYRYGWDEETATRFALREL
DYVLQTISPPDDTAAIIVEPVLGEGGYVPATEGFLQGLRERADRHGFLLILDEVQTGVGR
TGRFWGHDHFGVQPDILVTAKGLASGFPLSGIAASEELMSKAWPGSQGGTYGANAVACAA
AVATLDVVREENLVANAEAMGARLRGGLEEVAAKTPAIGDVRGLGLMLASEFVTEEGEPD
PATAARVQRAAVDEGLLLLLCGAWNHVVRMIPALVVDEAAIDEGLRAWSAAVTAGTADS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatctgtcgccgcagctccgtcaggccactccggtggtcgccgtccggggagag
ggcgtccatgtcgacggcgaggacgggcggcgatacctcgacttcaccgcgggcatcggc
gtcaccagcaccgggcactgccatccgcgggtcgtcgccgccgcccaggagcaggtgggc
accctcatccacggccagtacacgaccgtcatgcacccgccgctgcggcggctggtcgag
aagctgggcgaggtgcttcccgccggcctcgacagtctgttcttcaccaactccggcagc
gaggccgtggagtcggccctgcgcctggcccgccaggccaccggccggcccaacgtcctg
gtctgccacggcggattccacggccgcaccgtggccgccgcctccatgaccacctccgga
acgcgtttccgctccggtttctcgccgctgatgagcggcgtcgtggtgaccccgttcccc
acggcctaccggtacggctgggacgaggagaccgcgacccggttcgccctgcgggagctg
gactacgtcctccagaccatctccccgcccgacgacaccgccgcgatcatcgtcgaaccg
gtgctcggcgagggcggctacgtgcccgccaccgagggcttcctccagggcctgcgggag
cgggccgaccgccatggcttcctgctgatcctggacgaggtgcagaccggggtgggccgc
accggacggttctggggccatgaccacttcggcgtccagcccgacatcctggtcaccgcc
aaggggctggccagcggcttcccgctgtccggcatcgccgcctccgaggagctgatgagc
aaggcgtggcccggctcccagggcggcacctacggcgccaacgcggtggcctgcgcggcg
gccgtcgccaccctcgacgtggtccgcgaggagaacctcgtcgccaacgccgaggccatg
ggggcgcggctgcgcggcggcctggaggaggtggccgccaagacccccgccatcggcgat
gtgcgcggcctcggcctcatgctggccagcgagttcgtcaccgaggagggcgagccggac
ccggcgaccgcggcccgggtgcagcgcgccgccgtggacgaagggctgttgctgctcctg
tgcggggcctggaaccatgtggtccggatgatccccgccctcgtcgtcgacgaagcggcg
atcgacgagggtctgcgcgcctggtccgccgccgtcaccgccggcacagcggactcctga

DBGET integrated database retrieval system