KEGG   Staphylococcus aureus subsp. aureus ST228/16035 (MRSA): SAI4T8_1001200Help
Entry
SAI4T8_1001200    CDS       T03146                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sauq  Staphylococcus aureus subsp. aureus ST228/16035 (MRSA)
Pathway
sauq00010  Glycolysis / Gluconeogenesis
sauq00053  Ascorbate and aldarate metabolism
sauq00071  Fatty acid degradation
sauq00280  Valine, leucine and isoleucine degradation
sauq00310  Lysine degradation
sauq00330  Arginine and proline metabolism
sauq00340  Histidine metabolism
sauq00380  Tryptophan metabolism
sauq00410  beta-Alanine metabolism
sauq00561  Glycerolipid metabolism
sauq00620  Pyruvate metabolism
sauq00625  Chloroalkane and chloroalkene degradation
sauq01100  Metabolic pathways
sauq01110  Biosynthesis of secondary metabolites
sauq01120  Microbial metabolism in diverse environments
sauq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sauq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAI4T8_1001200
   00053 Ascorbate and aldarate metabolism
    SAI4T8_1001200
   00620 Pyruvate metabolism
    SAI4T8_1001200
  Lipid metabolism
   00071 Fatty acid degradation
    SAI4T8_1001200
   00561 Glycerolipid metabolism
    SAI4T8_1001200
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAI4T8_1001200
   00310 Lysine degradation
    SAI4T8_1001200
   00330 Arginine and proline metabolism
    SAI4T8_1001200
   00340 Histidine metabolism
    SAI4T8_1001200
   00380 Tryptophan metabolism
    SAI4T8_1001200
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAI4T8_1001200
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAI4T8_1001200
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAI4T8_1001200
Enzymes [BR:sauq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAI4T8_1001200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: CCJ25820
LinkDB All DBs
Position
161034..162521
Genome map
AA seq 495 aa AA seqDB search
MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQ
EAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPIRETTAIDIPFAARHFH
YFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPMLLAAWKIAPAIAAGNTIV
IQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIFNHDGVDKLSFTGSTDVGY
QVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLGILFNQGEVCSAGSRLLVHE
KIYDQLVPRLQEAFSNIKVGDPQDEATQMGSQTGKDQLDKIQSYIDAAKESDAQILAGGH
RLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTVIKVKDDQEAIDIANDSEYGLA
GGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFGGYKKSGIGRETYKGALSNYQQV
KNIYIDTSNALKGLY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaacgttcgagattatattgcagagaattatggtttatttatcaatggggaa
tttgttaaaggtagcagtgacgaaacaatcgaagtgactaatccagcaactggagaaaca
ctatcacatattacaagagcaaaagataaagatgtcgatcatgcagtcaaagtggcgcaa
gaggcatttgaatcatggtcattaacttctaaatcagaacgtgcacaaatgttgcgtgat
attggtgataaattaatggcacaaaaagataaaattgcaatgattgaaacattaaataat
ggtaaaccgattcgtgagacaacagcaattgatattccatttgctgcaagacatttccat
tatttcgcaagtgttattgaaacagaagaaggtacagtaaatgatatcgataaagacaca
atgagtatcgtacgacatgagccgattggcgtcgtaggtgctgttgttgcttggaacttc
ccaatgctattagctgcatggaagattgcgccagccattgctgcaggtaatacaattgtg
attcaaccttcgtcttcaacaccattaagtttattggaagttgctaaaattttccaagag
gtattacctaaaggtgttgtcaatatactaacgggtaaaggttcagaatcaggtaatgca
attttcaatcatgatggtgtagataaattatcatttacgggctcaactgatgtaggttat
caagttgccgaagctgcagcaaaacatctagtacccgctacattagagcttggtggtaaa
agcgccaatatcatattagatgatgctaatttagaccttgcagttgaaggtattcagtta
ggtattttattcaaccaaggtgaagtatgtagtgcaggttctcgattattagttcatgaa
aaaatttatgatcaattggtgccacgtttacaagaggcattttcaaatattaaagttgga
gatccacaagatgaagctacacaaatgggtagtcaaactggtaaggatcaattagataaa
attcaatcatatattgatgcagcaaaagaatcagatgcacaaattttagcaggtggtcat
cgcttaactgaaaatggattagataaagggttcttctttgagccgacattaattgctgtg
ccagacaatcatcacaaattagcacaagaagaaatatttggaccagtgttaacagtgatt
aaagtgaaggacgatcaagaagcaattgatatagctaatgattctgagtatggtttagca
ggcggtgtattttctcaaaatatcacacgtgcattaaatattgctaaagctgtacgtaca
ggacgtatttggattaacacttacaaccaagtaccagaaggcgcaccatttggtggttat
aaaaaatcaggtatcggtcgagaaacttataaaggtgcgttaagtaactatcaacaagtt
aaaaatatttatattgatacaagcaatgctttaaaaggtttgtactag

DBGET integrated database retrieval system