KEGG   Staphylococcus aureus subsp. aureus ST228/16035 (MRSA): SAI4T8_1007130Help
Entry
SAI4T8_1007130    CDS       T03146                                 

Gene name
fabI
Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sauq  Staphylococcus aureus subsp. aureus ST228/16035 (MRSA)
Pathway
sauq00061  Fatty acid biosynthesis
sauq00780  Biotin metabolism
sauq01100  Metabolic pathways
sauq01130  Biosynthesis of antibiotics
sauq01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sauq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SAI4T8_1007130 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SAI4T8_1007130 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SAI4T8_1007130 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sauq01004]
    SAI4T8_1007130 (fabI)
Enzymes [BR:sauq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SAI4T8_1007130 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SAI4T8_1007130 (fabI)
Lipid biosynthesis proteins [BR:sauq01004]
 Fatty acid synthase
  Component type
   SAI4T8_1007130 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: CCJ26395
LinkDB All DBs
Structure
PDB: 

Position
962659..963429
Genome map
AA seq 256 aa AA seqDB search
MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
HLYQIDVQSDEEVINGFEQIGKDVGNIDGVFHSIAFANMEDLRGRFSETSREGFLLAQDI
SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP
DNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG
VTGENIHVDSGFHAIK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatcttgaaaacaaaacatatgtcatcatgggaatcgctaataagcgtagtatt
gcttttggtgtcgctaaagttttagatcaattaggtgctaaattagtatttacttaccgt
aaagaacgtagccgtaaagagcttgaaaaattattagaacaattaaatcaaccagaagcg
cacttatatcaaattgatgttcaaagcgatgaagaggttattaatggttttgagcaaatt
ggtaaagatgttggcaatattgatggtgtatttcattcaatcgcatttgctaatatggaa
gacttacgcggacgcttttctgaaacttcacgtgaaggcttcttgttagctcaagacatt
agttcttactcattaacaattgtggctcatgaagctaaaaaattaatgccagaaggtggt
agcattgttgcaacaacatatttaggtggcgaattcgcagttcaaaattataatgtgatg
ggtgttgctaaagcgagcttagaagcaaatgttaaatatttagcattagacttaggtcct
gataatattcgcgttaatgcaatttcagctggtccaatccgtacattaagtgcaaaaggt
gtgggtggtttcaatacaattcttaaagaaatcgaagagcgtgcacctttaaaacgtaac
gttgatcaagtagaagtaggtaaaacagcggcttacttattaagtgacttatcaagtggc
gttacaggtgaaaatattcatgtagatagcggattccacgcaattaaataa

DBGET integrated database retrieval system