KEGG   Staphylococcus aureus subsp. aureus ST228/16035 (MRSA): SAI4T8_1015640Help
Entry
SAI4T8_1015640    CDS       T03146                                 

Gene name
aldA
Definition
(GenBank) Aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sauq  Staphylococcus aureus subsp. aureus ST228/16035 (MRSA)
Pathway
sauq00010  Glycolysis / Gluconeogenesis
sauq00053  Ascorbate and aldarate metabolism
sauq00071  Fatty acid degradation
sauq00280  Valine, leucine and isoleucine degradation
sauq00310  Lysine degradation
sauq00330  Arginine and proline metabolism
sauq00340  Histidine metabolism
sauq00380  Tryptophan metabolism
sauq00410  beta-Alanine metabolism
sauq00561  Glycerolipid metabolism
sauq00620  Pyruvate metabolism
sauq00625  Chloroalkane and chloroalkene degradation
sauq01100  Metabolic pathways
sauq01110  Biosynthesis of secondary metabolites
sauq01120  Microbial metabolism in diverse environments
sauq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sauq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAI4T8_1015640 (aldA)
   00053 Ascorbate and aldarate metabolism
    SAI4T8_1015640 (aldA)
   00620 Pyruvate metabolism
    SAI4T8_1015640 (aldA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAI4T8_1015640 (aldA)
   00561 Glycerolipid metabolism
    SAI4T8_1015640 (aldA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAI4T8_1015640 (aldA)
   00310 Lysine degradation
    SAI4T8_1015640 (aldA)
   00330 Arginine and proline metabolism
    SAI4T8_1015640 (aldA)
   00340 Histidine metabolism
    SAI4T8_1015640 (aldA)
   00380 Tryptophan metabolism
    SAI4T8_1015640 (aldA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAI4T8_1015640 (aldA)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAI4T8_1015640 (aldA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAI4T8_1015640 (aldA)
Enzymes [BR:sauq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAI4T8_1015640 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CCJ27201
LinkDB All DBs
Structure
PDB: 

Position
complement(2122680..2124107)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADDVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatacattaatggcgaatgggtagaaagtaatagtaatgaa
acgatagaagttataaatccagcaaccgaagaagtaatcgggaaagttgctaaaggtaat
aaagctgatgttgataaagccgtcgaggcggcagacgatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagcgttattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgaattaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaaccattttgttgcagcgagagacgcattagataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagcaatcggtgtatct
ggattaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcagcagca
tttgcggctggtagtccagttgtacttaaaccatctgaagaaacaccatttgcagctgtt
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctggtgttgggaatcctttatctgaacatcctaaagtacgcatgatgtca
ttcacaggatcaggccctactggttctaaaattatggaaaaagccgctaaagattttaaa
aaggtatcattagagcttggtggcaaatcaccatatatcgtcctagatgacgtagatatt
aaagaagcggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctaacaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcggtaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagaa
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtagataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcagttatcacttataacgatttagatgaagcgattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gatttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggatattttaaataa

DBGET integrated database retrieval system