KEGG   Staphylococcus aureus subsp. aureus ST228/16035 (MRSA): SAI4T8_1017920Help
Entry
SAI4T8_1017920    CDS       T03146                                 

Gene name
gpm
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sauq  Staphylococcus aureus subsp. aureus ST228/16035 (MRSA)
Pathway
sauq00010  Glycolysis / Gluconeogenesis
sauq00260  Glycine, serine and threonine metabolism
sauq00680  Methane metabolism
sauq01100  Metabolic pathways
sauq01110  Biosynthesis of secondary metabolites
sauq01120  Microbial metabolism in diverse environments
sauq01130  Biosynthesis of antibiotics
sauq01200  Carbon metabolism
sauq01230  Biosynthesis of amino acids
Module
sauq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sauq_M00002  Glycolysis, core module involving three-carbon compounds
sauq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sauq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAI4T8_1017920 (gpm)
  09102 Energy metabolism
   00680 Methane metabolism
    SAI4T8_1017920 (gpm)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAI4T8_1017920 (gpm)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sauq04131]
    SAI4T8_1017920 (gpm)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sauq04147]
    SAI4T8_1017920 (gpm)
Enzymes [BR:sauq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAI4T8_1017920 (gpm)
Membrane trafficking [BR:sauq04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAI4T8_1017920 (gpm)
Exosome [BR:sauq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAI4T8_1017920 (gpm)
  Exosomal proteins of melanoma cells
   SAI4T8_1017920 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CCJ27421
LinkDB All DBs
Position
complement(2423850..2424536)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgccatcgatgtagcttttacatcgttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgaacgccactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaagaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccacctgctgaaaccgaagaacaacgtgaagcttacttagctgatcgtcgatataatcat
ttagataaacgtatgatgccttattctgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattaattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccgcttgtttatgaattaacggatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system