KEGG   Staphylococcus aureus Bmb9393 (MRSA): SABB_00206Help
Entry
SABB_00206        CDS       T02717                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
saur  Staphylococcus aureus Bmb9393 (MRSA)
Pathway
saur00564  Glycerophospholipid metabolism
saur01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SABB_00206 (glpD)
Enzymes [BR:saur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SABB_00206 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 Pyr_redox_2 Pyr_redox Lycopene_cycl NAD_binding_8 FAD_oxidored GIDA 3HCDH_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: AGP28270
UniProt: A0A0D6GSN2
LinkDB All DBs
Position
complement(1446509..1448182)
Genome map
AA seq 557 aa AA seqDB search
MALSTFKREHIKKNLRNDEYDLVIIGGGITGAGIALDASERGMKVALVEMQDFAQGTSSR
STKLVHGGLRYLKQFQIGVVAETGKERAIVYENGPHVTTPEWMLLPMHKGGTFGKFSTSI
GLGMYDRLAGVKKSERKKMLSKKETLAKEPLVKKEGLKGGGYYVEYRTDDARLTIEVMKR
AAEKGAEIINYTKSEHFTYDKNQQVNGVKVIDKLTNENYTIKAKKVVNAAGPWVDDVRSG
DYARNNKKLRLTKGVHVVIDQSKFPLGQAVYFDTEKDGRMIFAIPREGKAYVGTTDTFYD
NIKSSPLTTQEDRDYLIDAINYMFPSVNVTDEDIESTWAGIRPLIYEEGKDPSEISRKDE
IWEGKSGLLTIAGGKLTGYRHMAQDIVDLVSKRLKKDYGLTFSPCNTKGLAISGGDVGGS
KNFDAFVEQKVDVAKGFGIDEDVARRLASKYGSNVDELFNIAQTSQYHDSKLPLEIYVEL
VYSIQQEMVYKPNDFLVRRSGKMYFNIKDVLDYKDAVIDIMADMLDYSPAQIEAYTEEVE
QAIKEAQHGNNQPAVKE
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcattgtctacttttaagagagaacatattaaaaagaatttaagaaatgatgaatat
gatttagtaattattggtggcggtattacaggtgcaggtattgcactagacgcgagtgaa
agaggaatgaaagttgcattagttgaaatgcaagactttgcacaaggaacaagctcaaga
tctacaaaattagtccatggtggtttgcgttacttaaaacaattccaaattggagtagtt
gccgaaactggtaaagaacgtgcgattgtttatgaaaatgggcctcatgttacgactcca
gagtggatgcttttaccaatgcataaaggtggaacatttggtaaattctcaacatcaatt
ggtttaggaatgtatgatcgtttagcaggtgttaagaagtctgaacgtaaaaaaatgtta
tctaaaaaagaaactttagctaaagaaccattagttaaaaaagaaggtctaaaaggcggc
ggttactatgttgaatatcgtactgacgatgcgcgtttaactattgaagttatgaagcgt
gctgctgaaaaaggcgcagaaattatcaactatactaaatctgaacacttcacttatgat
aaaaatcaacaagtaaatggtgttaaagttatagataaattaactaatgaaaattataca
attaaggctaaaaaagtggttaatgcagcaggtccatgggttgatgatgttagaagtggt
gattatgcacgcaataataaaaaattacgtttaactaaaggtgtacatgttgttattgat
caatcaaaattcccattaggtcaagcagtatactttgatactgaaaaagatggaagaatg
atttttgcaattccacgtgaaggaaaagcgtatgtaggtactacagatacattctatgac
aatatcaaatcttcaccattaactacacaagaagacagagactatttaatcgatgcgatt
aattacatgttccctagtgttaatgttacagatgaagatattgaatcaacatgggcagga
attagaccattaatttacgaagaaggcaaagacccttctgaaatctctcgtaaggatgaa
atttgggaaggtaaatcaggtttattaactattgcaggtggtaaattaacaggctatcgt
cacatggctcaagacattgttgatttagtatctaaacgcttgaaaaaagactacggttta
acatttagtccatgtaatacaaaaggtctggcaatttcaggtggcgatgtaggtggtagc
aagaactttgatgcgtttgtagagcaaaaagtagatgtagctaaaggattcggcattgat
gaagatgttgcaagacgtttagcatctaaatatggttcaaatgttgatgaattgttcaac
attgcgcaaacatctcaataccatgatagcaagttaccattagaaatttatgtagaactt
gtttatagtattcaacaagaaatggtatacaaacctaacgatttcttagttcgtcgttct
ggtaaaatgtatttcaatattaaagatgtattagattataaagatgctgtcatcgatatt
atggcagatatgcttgattactctccagctcaaattgaagcatatactgaagaagttgag
caagcaattaaagaagcgcaacatggaaataatcaaccagcagttaaagaataa

DBGET integrated database retrieval system