KEGG   Staphylococcus aureus Bmb9393 (MRSA): SABB_00272Help
Entry
SABB_00272        CDS       T02717                                 

Definition
(GenBank) chromosome segregation protein
  KO
K03529  chromosome segregation protein
Organism
saur  Staphylococcus aureus Bmb9393 (MRSA)
Brite
KEGG Orthology (KO) [BR:saur00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:saur03036]
    SABB_00272
Chromosome and associated proteins [BR:saur03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    SABB_00272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_15 AAA_21 AAA_29 AAA_23 FliJ Mod_r SbcCD_C FUSC
Motif
Other DBs
NCBI-ProteinID: AGP28336
UniProt: A0A0D3Q6Z6
LinkDB All DBs
Position
complement(1526753..1530319)
Genome map
AA seq 1188 aa AA seqDB search
MVYLKSIDAIGFKSFADQTNVQFDKGVTAIVGPNGSGKSNITDAIKWVLGEQSAKSLRGS
KMEDIIFSGAEHRKAQNYAEVQLRLDNHSKKLSVDENEVIVTRRLYRSGESEYYINNDRA
RLKDIADLFLDSGLGKEAYSIISQGRVDEILNAKPIDRRQIIEESAGVLKYKKRKAESLN
KLDQTEDNLTRVEDILYDLEGRVEPLKEEAAIAKEYKTLSHQMKHSDIVVTVHDIDQYTN
DNRQLDQRLNDLQGQQANKEADKQRLSQQIQQYKGKRHQLDNDVESLNYQLVKATEAFEK
YTGQLNVLEERKKNQSETNARYEEEQENLMELLENISNEISEAQDTYKSLKSKQKELNAV
IRELEEQLYVSDEAHDEKLEEIKNEYYTLMSEQSDVNNDIRFLKHTIEENEAKKSRLDSR
LVEVFEQLKDIQGQIKTTKKEYQQTNKELSAVDKEIKNIEKDLTDTKKAQNEYEEKLYQA
YRYTEKMKTRIDSLATQEEEYTYFFNGVKHILKAKNKELKGIYGAVAEIIDVPSKLTQAI
ETALGASLQHVIVDSEKDGRQAIQFLKERNLGRATFLPLNVIQSRVVATDIKSIAKEANG
FISIASEAVKVAPEYQNIIGNLLGNTIIVDHLKHANELARAIKYRTRIVTLEGDIVNPGG
SMTGGGARKSKSILSQKDELTTMRHQLEDYLRQTESFEQQFKELKIKSDQLSELYFEKSQ
KHNTLKEQVHHFEMELDRLTTQETQIKNDHEEFEFEKNDGYTSDKSRQTLSEKETYLESI
KASLKRLEDEIERYTKLSKEGKESVTKTQQTLHQKQSDLAVVKERIKTQQQTIDRLNNQN
QQTKHQLKDVKEKIAFFNSDEVMGEQAFQNIKDQINGQQETRTRLSDELDKLKQQRIELN
EQIDAQEAKLQVCHQDILAIENHYQDIKAEQSKLDVLIHHAIDHLNDEYQLTVERAKSEY
TSDESIDALRKKVKLMKMSIDELGPVNLNAIEQFEELNERYTFLSEQRTDLRKAKETLEQ
IISEMDQEVTERFKETFHAIQGHFTAVFKQLFGGGDAELQLTEADYLTAGIDIVVQPPGK
KLQHLSLLSGGERALTAIALLFAILKVRSAPFVILDEVEAALDEANVIRYAKYLNELSDE
TQFIVITHRKGTMEFADRLYGVTMQESGVTKLVSVNLNTIDDVLKEEQ
NT seq 3567 nt NT seq  +upstreamnt  +downstreamnt
atggtttatttaaaatcaatagatgccattggatttaagtcttttgcagatcaaaccaat
gttcaattcgataaaggtgtaactgcaattgttggtccaaatggaagcggtaaaagtaat
attacagatgctattaaatgggtgttgggtgaacaatcggctaaatcattacgtggctca
aaaatggaagatattatcttctcaggtgcagaacatcgcaaagctcaaaattatgctgaa
gtacagttaagattagataatcattctaaaaagctcagtgttgatgaaaacgaagttatt
gtaacaagaagattgtatcgaagtggtgaaagtgagtactacataaataatgaccgtgca
agattaaaagatattgccgatttatttttagattctggattgggaaaagaagcgtatagc
attatctcgcaaggtagagttgatgaaatactaaatgctaaaccaattgatagacgtcaa
attattgaagaatcggctggtgtacttaaatataaaaaacgtaaggctgaatcattaaat
aaacttgaccaaacagaagataatttaacgagagtagaagacattttatatgatttggaa
ggtcgcgtagaacctctaaaagaggaggcagctatagctaaagaatataagacactttca
catcaaatgaaacatagtgacattgtagttacagtgcacgatattgatcaatatacaaat
gacaatagacaattagatcaacgtttaaatgatttacaaggccaacaagcaaataaagaa
gctgacaagcaacgtttaagccaacaaattcaacaatataaaggtaaacgtcatcaactt
gataatgatgttgaatcgcttaattatcaattagtaaaagctacggaagcctttgaaaaa
tatacgggacaattaaatgttttggaagaacgtaagaaaaatcaatctgaaacaaatgca
cgatatgaagaagaacaagaaaatttaatggagcttttagaaaatatatcaaatgagatt
tctgaagctcaagatacttataagtctctgaaaagtaaacaaaaagaactcaatgctgtc
attcgtgaacttgaagaacaactatatgtttcagacgaagcacatgatgaaaaattggaa
gaaattaaaaacgaatactatacattaatgtcagagcaatcagatgttaacaatgatatt
cgttttttaaagcatactatagaagagaatgaggctaaaaaatcaagactagattctcga
ttagttgaagtttttgagcaattgaaagatattcagggtcaaataaaaacgacaaaaaaa
gaatatcaacagaccaacaaagaactttctgctgtagataaagaaattaaaaatatagaa
aaagacctcactgatacaaaaaaagcacaaaatgaatacgaagagaaattgtatcaagca
tatcgatataccgaaaaaatgaaaacacgtattgatagtttggcaacgcaagaggaagaa
tatacttattttttcaatggcgtcaaacatattttgaaagctaaaaataaagaattaaag
ggtatttatggtgcagttgcggaaattattgatgtgccatctaaattaactcaggcaatt
gaaacagcattaggtgcttcattacaacatgtcattgtagattcagaaaaagatggacgc
caggctattcaatttttaaaagaacgtaatttaggtcgtgcgacgtttttaccattaaat
gttatacagagtagagtggtagcgactgatattaaatctattgctaaagaggcaaacgga
tttattagtatcgcttcggaagcagttaaagtagcaccagaatatcaaaatattatcggg
aatttattaggtaatacgattatcgttgatcatttaaagcatgcaaatgaattggcacgt
gcgattaaatatcgaactcgtattgttactttggaaggtgatattgtaaatcctggtggt
tctatgactggtggtggcgctcgtaagtcaaaaagtattctgtctcaaaaagacgagttg
acaacaatgagacaccaattagaagattacttgcgtcaaacagaatcatttgaacaacaa
tttaaagagttgaagataaaaagtgatcaattaagtgaactgtattttgaaaaaagtcaa
aagcataatacacttaaagagcaagtgcatcattttgaaatggagctcgatagattaact
acacaagaaacacaaataaaaaatgatcatgaagaattcgaatttgaaaaaaatgatggt
tatacgagtgacaaaagtcgacaaactttgagtgaaaaagaaacttatctagaaagtatt
aaagcatctttaaaacgactagaagatgaaattgaacgctacacaaaactttctaaagaa
ggtaaggaaagcgttactaaaacacaacaaaccttacatcagaaacaatctgatcttgct
gtggttaaagagcgtattaaaacacaacaacagacaatagatcgattaaataatcaaaat
caacaaactaaacatcaattaaaagatgttaaagaaaaaattgcattctttaattcggat
gaagtgatgggcgaacaagcttttcaaaatattaaagatcaaattaatggtcaacaagaa
acgagaacacgcttatcagatgaattagataaattgaaacaacaacgtattgagttgaat
gaacaaatcgatgcgcaagaagctaaactacaagtttgtcaccaagatattttagctatc
gaaaatcactaccaagatattaaagctgaacaatcaaagctagatgtattaattcatcat
gcgatagatcatttaaatgatgaatatcaattgactgttgaacgtgcgaaatctgaatat
acgagtgatgaatcgattgacgcattacgtaaaaaagttaagttaatgaagatgtcgatt
gatgaactaggtcctgtaaacttaaatgcaattgaacaatttgaagagttaaatgaacgt
tatacatttttaagtgaacaacgtacagatcttcgtaaagctaaagaaacattagagcaa
attataagtgaaatggatcaagaggttactgaaagatttaaagaaactttccatgctatt
caaggacattttacagctgtgttcaaacaattgtttggtggaggcgatgcagaattgcaa
ttaactgaagccgattatttaacagctggtattgatattgtggtacaaccaccgggtaaa
aagttgcaacatttatcgttactgagtggtggtgagcgtgcattaactgctattgcttta
ctatttgcaattttaaaagtaagatctgcaccttttgttatattagatgaggttgaagct
gcactagatgaagcaaatgttattagatacgcaaaatatttaaatgagttatcagacgaa
acacaattcattgttattacacaccgtaaaggaacaatggaatttgcagataggttatac
ggtgtaacaatgcaagaatcaggtgttactaaacttgtgagtgtgaatttaaatacaata
gatgatgtgttgaaggaggagcaataa

DBGET integrated database retrieval system