KEGG   Staphylococcus aureus Bmb9393: SABB_01260Help
Entry
SABB_01260        CDS       T02717                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
saur  Staphylococcus aureus Bmb9393
Pathway
saur00010  Glycolysis / Gluconeogenesis
saur00260  Glycine, serine and threonine metabolism
saur00680  Methane metabolism
saur01100  Metabolic pathways
saur01110  Biosynthesis of secondary metabolites
saur01120  Microbial metabolism in diverse environments
saur01130  Biosynthesis of antibiotics
saur01200  Carbon metabolism
saur01230  Biosynthesis of amino acids
Module
saur_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
saur_M00002  Glycolysis, core module involving three-carbon compounds
saur_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:saur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SABB_01260 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    SABB_01260 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SABB_01260 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:saur04131]
    SABB_01260 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saur04147]
    SABB_01260 (gpmA)
Enzymes [BR:saur01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SABB_01260 (gpmA)
Membrane trafficking [BR:saur04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SABB_01260 (gpmA)
Exosome [BR:saur04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SABB_01260 (gpmA)
  Exosomal proteins of melanoma cells
   SABB_01260 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AGP29351
UniProt: W8TQX1
LinkDB All DBs
Position
complement(2626656..2627342)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgccatcgatgtagcttttacatcgttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgaacgccactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaagaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccacctgctgaaaccgaagaacaacgtgaagcttacttagctgatcgtcgatataatcat
ttagataaacgtatgatgccttattctgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattgattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccgcttgtttatgaattaacggatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system