KEGG   Staphylococcus aureus subsp. aureus SA40 (CA-MRSA): SA40_0008Help
Entry
SA40_0008         CDS       T02849                                 

Definition
(GenBank) hypothetical protein
  KO
K17758  ADP-dependent NAD(P)H-hydrate dehydratase [EC:4.2.1.136]
Organism
saus  Staphylococcus aureus subsp. aureus SA40 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:saus00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SA40_0008
Enzymes [BR:saus01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.136  ADP-dependent NAD(P)H-hydrate dehydratase
     SA40_0008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carb_kinase Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AGW35056
LinkDB All DBs
Position
complement(10497..11309)
Genome map
AA seq 270 aa AA seqDB search
METLNSINIPKRKEDSHKGDYGKILLIGGSANLGGAIMLAARACVFSGSGLITVATHPTN
HSALHSRCPEAMVIDINDTKMLTKMIEMTDSILIGPGLGVDFKGNNAITFLLQNIQPHQN
LIVDGDAITIFSKLKPQLPTCRVIFTPHLKEWERLSGIPIEEQTYERNREAVDRLGATVV
LKKHGTEIFFKDEDFKLTIGSPAMATGGMGDTLAGMITSFVGQFDNLKEAVMSATYTHSF
IGENLAKDMYVVPPSRLINEIPYAMKQLES
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgttaaattctattaacattcctaagcgtaaagaagattcacataaaggtgat
tatggcaaaattttattaattggtggatctgctaacttaggtggtgccattatgttagcg
gctcgtgcatgtgtatttagcggtagtggtttaatcactgtagctacacatccaacaaat
cattcagcattacattctcgttgcccagaagcgatggttattgatattaatgatacgaaa
atgttgacgaaaatgattgaaatgactgacagtatactaattggtccaggtcttggcgtt
gatttcaaaggaaataatgccattacattcctactacaaaatatacaaccgcatcaaaat
ttaatcgtagacggcgatgcgattacaatatttagtaaactgaaaccgcaattacctaca
tgtcgcgtgatttttactccgcatctcaaagaatgggagcgattaagtggtattcctatt
gaggaacagacatatgagcgtaatcgtgaagcagttgatcgtttaggcgcaactgttgta
cttaaaaaacatggtactgaaattttctttaaagatgaagactttaaattaacaatcggt
agcccagcaatggcgactggtggtatgggcgatacacttgctggtatgattacaagtttt
gttggtcaatttgataacttaaaagaagcggttatgagtgccacatatacacatagtttt
attggcgaaaatcttgcaaaagatatgtatgtggtgccaccatcaagacttatcaatgaa
ataccttacgcaatgaaacaattagaaagttaa

DBGET integrated database retrieval system