KEGG   Staphylococcus aureus subsp. aureus SA40 (CA-MRSA): SA40_0206Help
Entry
SA40_0206         CDS       T02849                                 

Definition
(GenBank) putative zinc-binding dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
saus  Staphylococcus aureus subsp. aureus SA40 (CA-MRSA)
Pathway
saus00040  Pentose and glucuronate interconversions
saus00051  Fructose and mannose metabolism
saus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SA40_0206
   00051 Fructose and mannose metabolism
    SA40_0206
Enzymes [BR:saus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SA40_0206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AdoHcyase_NAD FAD_binding_3 NAD_binding_3 TrkA_N ADH_N_2 CHASE4
Motif
Other DBs
NCBI-ProteinID: AGW35254
LinkDB All DBs
Position
254054..255109
Genome map
AA seq 351 aa AA seqDB search
MKALVKTREGHGNLELLDKEVATPLDDKVKIKVHYAGICGTDIHTYEGHYKVNFPVTLGH
EFSGEIVEVGADVKDFKVGDRVTSETTFYVCNECEYCESKDYNLCNYRKGIGTQVDGAFT
NYVIAREESLHHIPDEVSYQSAAMTEPLACAHHGVSKIQVNSGDVAVVMGPGPIGLLVAQ
VLKSKGAIVVVTGLDNDKVRLDKAEALHMDYVVNLQQTDLKTYINGITDGYGADVVVECS
GAVPAARQGLDILRKKGFYSQIGIFKDAEIPFDMEKVIQKEITVVGSRSQKPADWEPSLQ
LMADGLVNAEALVTKIYDISKWDEAYQHLKSGEGIKALLKPLDLDENEGEN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctttagtaaaaacaagagaaggacatggcaacttagaacttcttgataaagaa
gttgcaacaccgctagatgataaagtaaagattaaagtacattatgcaggaatttgtggc
acagatattcatacttatgaaggtcattataaagttaattttccagtgacattaggtcat
gaattttctggtgaaatcgttgaagttggagcagacgttaaagattttaaagttggtgac
cgtgtcacttctgaaacgacattctatgtttgtaatgagtgtgaatactgtgaatcaaaa
gactataatttatgcaactatcgaaaaggtattggaacacaagttgatggcgcatttact
aattatgtcattgcacgtgaagaaagtttgcatcatattccagatgaagtatcgtaccag
tctgcagctatgacagaaccattagcatgtgcacatcatggcgtttctaagattcaagtg
aactctggcgatgtagcagttgtaatgggacctgggccaatcggattacttgtagcacaa
gtgttaaaaagtaaaggcgcaattgttgtggtaacaggattggacaatgacaaagtcaga
ttagataaagcagaagcattgcacatggattatgtagtcaatttacaacaaacagactta
aaaacgtatatcaatggaattacagacggttacggtgcagatgttgttgttgaatgttca
ggtgcagttccagcagcacgacaaggtttggatattttacgcaaaaaaggtttctacagt
caaataggtatttttaaggatgctgaaattccatttgatatggaaaaagtgattcaaaaa
gaaataacagttgttggtagtagaagtcaaaagccagcagattgggaaccttcattgcaa
cttatggcggatggtttagtaaatgctgaagctctggtgacaaaaatatatgatatttcg
aaatgggacgaggcgtatcaacatttaaaatctggcgaaggtattaaagcattacttaag
ccgctcgatttagatgaaaatgaaggagagaattaa

DBGET integrated database retrieval system