KEGG   Staphylococcus aureus subsp. aureus SA40 (CA-MRSA): SA40_0789Help
Entry
SA40_0789         CDS       T02849                                 

Definition
(GenBank) hypothetical protein
Organism
saus  Staphylococcus aureus subsp. aureus SA40 (CA-MRSA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF72
Motif
Other DBs
NCBI-ProteinID: AGW35835
LinkDB All DBs
Position
874170..875018
Genome map
AA seq 282 aa AA seqDB search
MINIGLTGWGDHYSLYEDLERQTDKLKTYAGHFPVVELDATYYAIQPERNILKWIKETPD
TFEFVVKIHQALTLHAEYKTFADSRQELFDQFKNMIEPLHTQKKLAMVLVQFPPWFDCNA
QNIKYILYVRQQLQAFPMCVEFRHQSWFSDAFKEQTLAFLTEHQIIHAVVDEPQVKDGSV
PLVNRITNEIAFVRYHGRNHYGWTKKDMSDQEWRDVRYLYDYNEQELIDLAQKAQILAQK
AKKVYVIFNNNSGGHAANNAKTYQRLLNIEYEGLAPQQLKLF
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgataaacatcggattaacaggttggggtgatcactattcattatatgaagatttagaa
cgccaaaccgataaacttaaaacatatgctggacattttccggttgtcgaattagatgcg
acatactatgcgatacaaccggaaagaaatatattgaaatggataaaagaaacgcctgat
acatttgaatttgtggttaaaattcatcaagcactcacattgcatgcagagtacaaaaca
tttgcagattcaaggcaagaactatttgatcaatttaagaatatgatagagcccttacat
acacagaaaaaattagcaatggtattggttcaatttcctccatggtttgactgcaatgca
caaaatatcaaatatattttgtatgtaagacaacaattacaagcatttccaatgtgtgta
gaatttaggcatcaatcatggtttagtgatgcatttaaagaacaaacattggcattttta
acagaacatcaaatcattcatgcagtagttgatgaaccacaagtgaaagatggcagtgta
cctttagtcaatcgaatcacaaatgaaattgcgtttgtacgttatcatggacgtaatcat
tacggttggactaagaaagatatgtcagatcaagaatggcgagatgtacgctatttatat
gattataatgagcaagaattaatagacttggcacaaaaggcacaaatattagcacaaaaa
gctaagaaagtttacgtcatatttaacaataattctggtggtcatgcagcaaataatgcc
aaaacatatcagcgattattgaatatagaatatgaagggttagcaccacaacaattaaaa
ttattttaa

DBGET integrated database retrieval system