KEGG   Staphylococcus aureus subsp. aureus SA40 (CA-MRSA): SA40_0877Help
Entry
SA40_0877         CDS       T02849                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
saus  Staphylococcus aureus subsp. aureus SA40 (CA-MRSA)
Pathway
saus00061  Fatty acid biosynthesis
saus00780  Biotin metabolism
saus01100  Metabolic pathways
saus01130  Biosynthesis of antibiotics
saus01212  Fatty acid metabolism
Module
saus_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:saus00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SA40_0877 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SA40_0877 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SA40_0877 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:saus01004]
    SA40_0877 (fabI)
Enzymes [BR:saus01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SA40_0877 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SA40_0877 (fabI)
Lipid biosynthesis proteins [BR:saus01004]
 Fatty acid synthase
  Component type
   SA40_0877 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AGW35922
LinkDB All DBs
Structure
PDB: 

Position
970276..971046
Genome map
AA seq 256 aa AA seqDB search
MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
HLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDI
SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP
DNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG
VTGENIHVDSGFHAIK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatcttgaaaacaaaacatatgtcatcatgggaatcgctaataagcgtagtatt
gcttttggtgtcgctaaagttttagatcaattaggtgctaaattagtatttacttaccgt
aaagaacgtagccgtaaagagcttgaaaaattattagaacaattaaatcaaccagaagcg
cacttatatcaaattgatgttcaaagcgatgaagaggttattaatggttttgagcaaatt
ggtaaagatgttggcaatatcgatggtgtatatcattcaatcgcatttgctaatatggaa
gacttacgcggacgtttttctgaaacttcacgtgaaggtttcttgttagctcaagacatt
agttcttactcactaactatcgttgctcatgaagctaaaaaattaatgccagaaggtggt
agcattgttgcaacaacatatttaggtggcgaattcgcagttcaaaactacaatgtgatg
ggtgttgctaaagcgagcttagaagcaaatgttaaatatttagcattagacttaggtcca
gataatattcgcgttaatgcaatttcagctggtccaatccgtacattaagtgcaaaaggt
gtgggtggtttcaatacaattcttaaagaaatcgaagagcgtgcacctttaaaacgtaac
gttgatcaagtagaagtaggtaaaacagcggcttacttattaagtgacttatcaagtggc
gttacaggtgaaaatattcatgtagatagcggattccacgcaattaaataa

DBGET integrated database retrieval system