KEGG   Staphylococcus aureus subsp. aureus SA40 (CA-MRSA): SA40_1881Help
Entry
SA40_1881         CDS       T02849                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
saus  Staphylococcus aureus subsp. aureus SA40 (CA-MRSA)
Pathway
saus00010  Glycolysis / Gluconeogenesis
saus00053  Ascorbate and aldarate metabolism
saus00071  Fatty acid degradation
saus00280  Valine, leucine and isoleucine degradation
saus00310  Lysine degradation
saus00330  Arginine and proline metabolism
saus00340  Histidine metabolism
saus00380  Tryptophan metabolism
saus00410  beta-Alanine metabolism
saus00561  Glycerolipid metabolism
saus00620  Pyruvate metabolism
saus00625  Chloroalkane and chloroalkene degradation
saus01100  Metabolic pathways
saus01110  Biosynthesis of secondary metabolites
saus01120  Microbial metabolism in diverse environments
saus01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SA40_1881
   00053 Ascorbate and aldarate metabolism
    SA40_1881
   00620 Pyruvate metabolism
    SA40_1881
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SA40_1881
   00561 Glycerolipid metabolism
    SA40_1881
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SA40_1881
   00310 Lysine degradation
    SA40_1881
   00330 Arginine and proline metabolism
    SA40_1881
   00340 Histidine metabolism
    SA40_1881
   00380 Tryptophan metabolism
    SA40_1881
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SA40_1881
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SA40_1881
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SA40_1881
Enzymes [BR:saus01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SA40_1881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGW36925
LinkDB All DBs
Structure
PDB: 

Position
complement(2080906..2082333)
Genome map
AA seq 475 aa AA seqDB search
MRDYTKQYINGEWVKSNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADNVYLEFRH
TSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSERVHYQMGLNHFVAARDALDN
YEFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAV
ILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELK
EQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEGLEKGYF
ARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagagactacacaaagcaatacattaatggcgaatgggtaaaaagtaatagtaatgaa
acgatagaagttataaatccagcaactgaagaagtaattgggaaagttgctaaaggtaat
aaagctgatgttgataaagccgtcgaggcggcagataatgtttatttagagttccgtcat
acatctgtgaaagaaagacaagcattattagataaaattgtaaaagaatatgaaaacaga
aaagacgatattgtacaagctattacggatgagttaggtgctcctttatcattatctgag
cgtgtccattatcaaatgggactaaaccattttgttgcagcgagagacgcattagataac
tacgaatttgaagaacgccgcggagatgatttagttgttaaagaagcaatcggtgtatct
ggcttaattacaccgtggaacttccctacaaaccaaacatcattaaaattagcggcagca
tttgcggctggtagtccagttgtacttaaaccatcagaagaaacaccatttgcagctgtt
attttagctgagatttttgataaagtcggtgttcctaaaggtgtatttaaccttgttaat
ggtgatggtgctggagttgggaatcctttatctgaacatcctaaagtacgcatgatgtca
tttacaggatcaggccctactggttctaaaattatggaaaaagctgctaaagactttaaa
aaggtatcattagagcttggtggcaaatcaccatacatcgtcctagatgacgtagatatt
aaagaagcggctaaagcaacaacaggcaaagttgttaataatactggtcaagtatgtaca
gctggtacacgtgttttagtgcctaacaaaattaaagatgcattcttagctgaattaaaa
gaacaatttagccaagtgcgtgtcggtaatccaagagaagatggtacacaagtaggccct
atcattagtaaaaaacaatttgatcaagtacaaaattatattaataaaggtattgaagaa
ggtgctgaattattttatggtggtcctggtaaaccagaaggacttgaaaaaggatacttt
gcacgtccgacaatttttattaatgtagataatcaaatgacgatagcacaagaagaaatt
tttgggccagtaatgtcggttatcacttataacgatttagatgaagcgattcaaattgca
aatgatacaaaatatggtttggcaggatatgttattggtaaggacaaagaaacattgcat
aaagtagctcgttctattgaagcaggtacagtagaaataaacgaagcaggtagaaagcca
gacttaccatttggtggctataaacaatctggtttaggtcgtgaatggggcgattatggt
attgaagagttcttagaagtgaaatctatagctggctattttaaataa

DBGET integrated database retrieval system