KEGG   Staphylococcus aureus subsp. aureus SA40 (CA-MRSA): SA40_2165Help
Entry
SA40_2165         CDS       T02849                                 

Definition
(GenBank) putative phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
saus  Staphylococcus aureus subsp. aureus SA40 (CA-MRSA)
Pathway
saus00010  Glycolysis / Gluconeogenesis
saus00260  Glycine, serine and threonine metabolism
saus00680  Methane metabolism
saus01100  Metabolic pathways
saus01110  Biosynthesis of secondary metabolites
saus01120  Microbial metabolism in diverse environments
saus01130  Biosynthesis of antibiotics
saus01200  Carbon metabolism
saus01230  Biosynthesis of amino acids
Module
saus_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
saus_M00002  Glycolysis, core module involving three-carbon compounds
saus_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:saus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SA40_2165
  09102 Energy metabolism
   00680 Methane metabolism
    SA40_2165
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SA40_2165
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:saus04131]
    SA40_2165
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saus04147]
    SA40_2165
Enzymes [BR:saus01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SA40_2165
Membrane trafficking [BR:saus04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SA40_2165
Exosome [BR:saus04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SA40_2165
  Exosomal proteins of melanoma cells
   SA40_2165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AGW37207
LinkDB All DBs
Position
complement(2377447..2378133)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgccatcgatgtagcttttacatctttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgagcgtcactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaagaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccacctgctgaaaccgaagaacaacgtgaagcttacttagctgatcgtagatataatcat
ttagataaacgtatgatgccttattctgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattgattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccacttgtttatgaattaacggatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system